PDB entry 1xl8

View 1xl8 on RCSB PDB site
Description: Crystal structure of mouse carnitine octanoyltransferase in complex with octanoylcarnitine
Class: transferase
Keywords: carnitine, octanoyltransferase, octanoylcarnitine
Deposited on 2004-09-30, released 2004-10-19
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.199
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Peroxisomal carnitine O-octanoyltransferase
    Species: Mus musculus [TaxId:10090]
    Gene: Crot, Cot
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9DC50 (Start-611)
      • modified residue (126-127)
      • modified residue (155)
      • modified residue (160)
      • modified residue (176)
      • modified residue (295)
      • modified residue (332)
      • modified residue (334)
      • modified residue (442)
      • modified residue (468)
      • modified residue (482)
      • modified residue (492-493)
      • modified residue (557)
      • modified residue (594)
      • modified residue (602)
      • modified residue (606)
    Domains in SCOPe 2.07: d1xl8a1, d1xl8a2
  • Chain 'B':
    Compound: Peroxisomal carnitine O-octanoyltransferase
    Species: Mus musculus [TaxId:10090]
    Gene: Crot, Cot
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9DC50
      • modified residue (126-127)
      • modified residue (155)
      • modified residue (160)
      • modified residue (176)
      • modified residue (295)
      • modified residue (332)
      • modified residue (334)
      • modified residue (442)
      • modified residue (468)
      • modified residue (482)
      • modified residue (492-493)
      • modified residue (557)
      • modified residue (594)
      • modified residue (602)
      • modified residue (606)
    Domains in SCOPe 2.07: d1xl8b1, d1xl8b2
  • Heterogens: 152, OCB, MPD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1xl8A (A:)
    menqltksveertfqyqdslpslpvpaleeslkkylesvkpfanedeykkteeivqkfqe
    gagkrlhqkllerargkrnwleewwlnvayldvripsqlnvnfvgpcphfehywparegt
    qlergsmmlwhnlnywqllrreklpvhksgntpldmnqfrmlfstckvpgitrdsimnyf
    kteseghcpthiavlcrgrafvfdvlhegclitppellrqltyihkkcsnepvgpsiaal
    tseertrwakareylisldpenltllekiqtslfvysiedssphatpeeysqvfemllgg
    dpsvrwgdksynlisfangifgcccdhapydamvmvniahyvdervletegrwkgsekvr
    diplpeelvftvdekilndvsqakaqhlkaasdlqiaastftsfgkkltkeealhpdtfi
    qlalqlayyrlhgrpgccyetamtryfyhgrtetvrsctveavrwcqsmqdpsasllerq
    qkmleafakhnkmmkdcshgkgfdrhllgllliakeeglpvpelfedplfsrsggggnfv
    lstslvgylrvqgvvvpmvhngygffyhirddrfvvacsswrscpetdaeklvqmifhaf
    hdmiqlmntahl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xl8A (A:)
    ertfqyqdslpslpvpaleeslkkylesvkpfanedeykkteeivqkfqegagkrlhqkl
    lerargkrnwleewwlnvayldvripsqlnvnfvgpcphfehywparegtqlergsmmlw
    hnlnywqllrreklpvhksgntpldmnqfrmlfstckvpgitrdsimnyfkteseghcpt
    hiavlcrgrafvfdvlhegclitppellrqltyihkkcsnepvgpsiaaltseertrwak
    areylisldpenltllekiqtslfvysiedssphatpeeysqvfemllggdpsvrwgdks
    ynlisfangifgcccdhapydamvmvniahyvdervletegrwkgsekvrdiplpeelvf
    tvdekilndvsqakaqhlkaasdlqiaastftlhpdtfiqlalqlayyrlhgrpgccyet
    amtryfyhgrtetvrsctveavrwcqsmqdpsasllerqqkmleafakhnkmmkdcshgk
    gfdrhllgllliakeeglpvpelfedplfsrsggggnfvlstslvgylrvqgvvvpmvhn
    gygffyhirddrfvvacsswrscpetdaeklvqmifhafhdmiqlmntahl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1xl8B (B:)
    menqltksveertfqyqdslpslpvpaleeslkkylesvkpfanedeykkteeivqkfqe
    gagkrlhqkllerargkrnwleewwlnvayldvripsqlnvnfvgpcphfehywparegt
    qlergsmmlwhnlnywqllrreklpvhksgntpldmnqfrmlfstckvpgitrdsimnyf
    kteseghcpthiavlcrgrafvfdvlhegclitppellrqltyihkkcsnepvgpsiaal
    tseertrwakareylisldpenltllekiqtslfvysiedssphatpeeysqvfemllgg
    dpsvrwgdksynlisfangifgcccdhapydamvmvniahyvdervletegrwkgsekvr
    diplpeelvftvdekilndvsqakaqhlkaasdlqiaastftsfgkkltkeealhpdtfi
    qlalqlayyrlhgrpgccyetamtryfyhgrtetvrsctveavrwcqsmqdpsasllerq
    qkmleafakhnkmmkdcshgkgfdrhllgllliakeeglpvpelfedplfsrsggggnfv
    lstslvgylrvqgvvvpmvhngygffyhirddrfvvacsswrscpetdaeklvqmifhaf
    hdmiqlmntahl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xl8B (B:)
    ertfqyqdslpslpvpaleeslkkylesvkpfanedeykkteeivqkfqegagkrlhqkl
    lerargkrnwleewwlnvayldvripsqlnvnfvgpcphfehywparegtqlergsmmlw
    hnlnywqllrreklpvhksgntpldmnqfrmlfstckvpgitrdsimnyfkteseghcpt
    hiavlcrgrafvfdvlhegclitppellrqltyihkkcsnepvgpsiaaltseertrwak
    areylisldpenltllekiqtslfvysiedssphatpeeysqvfemllggdpsvrwgdks
    ynlisfangifgcccdhapydamvmvniahyvdervletegrwkgsekvrdiplpeelvf
    tvdekilndvsqakaqhlkaasdlqiaastftsfgkkltkeealhpdtfiqlalqlayyr
    lhgrpgccyetamtryfyhgrtetvrsctveavrwcqsmqdpsasllerqqkmleafakh
    nkmmkdcshgkgfdrhllgllliakeeglpvpelfedplfsrsggggnfvlstslvgylr
    vqgvvvpmvhngygffyhirddrfvvacsswrscpetdaeklvqmifhafhdmiqlmnta