PDB entry 1xl6

View 1xl6 on RCSB PDB site
Description: Intermediate gating structure 2 of the inwardly rectifying K+ channel KirBac3.1
Class: metal transport
Keywords: integral membrane protein, ion channel, inwardly rectifying K+ channel, METAL TRANSPORT
Deposited on 2004-09-30, released 2004-12-07
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.85 Å
R-factor: 0.27
AEROSPACI score: 0.17 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Inward rectifier potassium channel
    Species: Magnetospirillum magnetotacticum [TaxId:188]
    Database cross-references and differences (RAF-indexed):
    • GB ZP_00055625 (Start-294)
      • expression tag (295-300)
    Domains in SCOPe 2.06: d1xl6a1, d1xl6a2, d1xl6a3
  • Chain 'B':
    Compound: Inward rectifier potassium channel
    Species: Magnetospirillum magnetotacticum [TaxId:188]
    Database cross-references and differences (RAF-indexed):
    • GB ZP_00055625 (Start-294)
      • expression tag (295-300)
    Domains in SCOPe 2.06: d1xl6b1, d1xl6b2, d1xl6b3
  • Heterogens: K, MG, SPM, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1xl6A (A:)
    mtggmkpparkprilnsdgssnitrlglekrgwlddhyhdlltvswpvfitlitglylvt
    nalfalaylacgdvienarpgsftdafffsvqtmatigygklipigplantlvtlealcg
    mlglavaasliyarftrptagvlfssrmvisdfegkptlmmrlanlrieqiieadvhlvl
    vrseisqegmvfrrfhdltltrsrspifslswtvmhpidhhspiygetdetlrnshsefl
    vlftghheafaqnvharhayscdeiiwgghfvdvfttlpdgrraldlgkfheiaqhhhhh
    h
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xl6A (A:)
    kprilnsdgssnitrlglekrgwlddhyhdlltvswpvfitlitglylvtnalfalayla
    cgdvienarpgsftdafffsvqtmatigygklipigplantlvtlealcgmlglavaasl
    iyarftrptagvlfssrmvisdfegkptlmmrlanlrieqiieadvhlvlvrseisqegm
    vfrrfhdltltrsrspifslswtvmhpidhhspiygetdetlrnshseflvlftghheaf
    aqnvharhayscdeiiwgghfvdvfttlpdgrraldlgkfheiaqhhhhhh
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1xl6B (B:)
    mtggmkpparkprilnsdgssnitrlglekrgwlddhyhdlltvswpvfitlitglylvt
    nalfalaylacgdvienarpgsftdafffsvqtmatigygklipigplantlvtlealcg
    mlglavaasliyarftrptagvlfssrmvisdfegkptlmmrlanlrieqiieadvhlvl
    vrseisqegmvfrrfhdltltrsrspifslswtvmhpidhhspiygetdetlrnshsefl
    vlftghheafaqnvharhayscdeiiwgghfvdvfttlpdgrraldlgkfheiaqhhhhh
    h
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xl6B (B:)
    kprilnsdgssnitrlglekrgwlddhyhdlltvswpvfitlitglylvtnalfalayla
    cgdvienarpgsftdafffsvqtmatigygklipigplantlvtlealcgmlglavaasl
    iyarftrptagvlfssrmvisdfegkptlmmrlanlrieqiieadvhlvlvrseisqegm
    vfrrfhdltltrsrspifslswtvmhpidhhspiygetdetlrnshseflvlftghheaf
    aqnvharhayscdeiiwgghfvdvfttlpdgrraldlgkfheiaqhhhhhh