PDB entry 1xku

View 1xku on RCSB PDB site
Description: crystal structure of the dimeric protein core of decorin, the archetypal small leucine-rich repeat proteoglycan
Deposited on 2004-09-29, released 2004-11-02
The last revision prior to the SCOP 1.71 freeze date was dated 2004-11-09, with a file datestamp of 2004-11-09.
Experiment type: XRAY
Resolution: 2.15 Å
R-factor: 0.191
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.71: d1xkua_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1xkuA (A:)
    deasgigpeehfpevpeiepmgpvcpfrcqchlrvvqcsdlglekvpkdlppdtalldlq
    nnkiteikdgdfknlknlhtlilinnkiskispgafaplvklerlylsknqlkelpekmp
    ktlqelrvheneitkvrksvfnglnqmivvelgtnplkssgiengafqgmkklsyiriad
    tnittipqglppsltelhldgnkitkvdaaslkglnnlaklglsfnsisavdngslantp
    hlrelhlnnnklvkvpggladhkyiqvvylhnnnisaigsndfcppgyntkkasysgvsl
    fsnpvqyweiqpstfrcvyvraavqlgnyk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xkuA (A:)
    gpvcpfrcqchlrvvqcsdlglekvpkdlppdtalldlqnnkiteikdgdfknlknlhtl
    ilinnkiskispgafaplvklerlylsknqlkelpekmpktlqelrvheneitkvrksvf
    nglnqmivvelgtnplkssgiengafqgmkklsyiriadtnittipqglppsltelhldg
    nkitkvdaaslkglnnlaklglsfnsisavdngslantphlrelhlnnnklvkvpgglad
    hkyiqvvylhnnnisaigsndfcppgyntkkasysgvslfsnpvqyweiqpstfrcvyvr
    aavql