PDB entry 1xkt

View 1xkt on RCSB PDB site
Description: Human fatty acid synthase: Structure and substrate selectivity of the thioesterase domain
Class: hydroxylase
Keywords: Human fatty acid synthase, thioesterase, structure, specificity, drug target, hydroxylase
Deposited on 2004-09-29, released 2004-10-26
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.258
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: fatty acid synthase
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P49327 (4-288)
      • cloning artifact (3)
      • see remark 999 (226)
    Domains in SCOPe 2.08: d1xkta1, d1xkta2
  • Chain 'B':
    Compound: fatty acid synthase
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P49327 (4-288)
      • cloning artifact (3)
      • see remark 999 (226)
    Domains in SCOPe 2.08: d1xktb1, d1xktb2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1xktA (A:)
    gamvnlrsllvnpegptlmrlnsvqsserplflvhpiegsttvfhslasrlsiptyglqc
    traapldsihslaayyidcirqvqpegpyrvagysygacvafemcsqlqaqqspapthns
    lflfdgsptyvlaytqsyrakltpgceaeaeteaicffvqqftdmehnrvleallplkgl
    eervaaavdliikshqgldrqelsfaarsfyyklraaeqytpkakyygnvmllraktgga
    ygedlgadynlsqvcdgkvsvhviegdhrtllegsglesiisiihssla
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xktA (A:)
    vnlrsllvnpegptlmrlnsvqsserplflvhpiegsttvfhslasrlsiptyglqctra
    apldsihslaayyidcirqvqpegpyrvagysygacvafemcsqlqaqhnslflfdgspt
    ypgceaeaeteaicffvqqftdmehnrvleallplkgleervaaavdliikshqgldrqe
    lsfaarsfyyklraaeqytpkakyygnvmllraktglgadynlsqvcdgkvsvhviegdh
    rtllesglesiisiihssla
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1xktB (B:)
    gamvnlrsllvnpegptlmrlnsvqsserplflvhpiegsttvfhslasrlsiptyglqc
    traapldsihslaayyidcirqvqpegpyrvagysygacvafemcsqlqaqqspapthns
    lflfdgsptyvlaytqsyrakltpgceaeaeteaicffvqqftdmehnrvleallplkgl
    eervaaavdliikshqgldrqelsfaarsfyyklraaeqytpkakyygnvmllraktgga
    ygedlgadynlsqvcdgkvsvhviegdhrtllegsglesiisiihssla
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xktB (B:)
    vnlrsllvnpegptlmrlnsvqsserplflvhpiegsttvfhslasrlsiptyglqctra
    apldsihslaayyidcirqvqpegpyrvagysygacvafemcsqlqaqhnslflfdgspt
    ypgceaeaeteaicffvqqftdmehnrvleallplkgleervaaavdliikshqgldrqe
    lsfaarsfyyklraaeqytpkakyygnvmllraktglgadynlsqvcdgkvsvhviegdh
    rtllesglesiisiihssla