PDB entry 1xks

View 1xks on RCSB PDB site
Description: the crystal structure of the n-terminal domain of nup133 reveals a beta-propeller fold common to several nucleoporins
Deposited on 2004-09-29, released 2004-12-07
The last revision prior to the SCOP 1.71 freeze date was dated 2004-12-07, with a file datestamp of 2004-12-07.
Experiment type: XRAY
Resolution: 2.35 Å
R-factor: 0.2
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.71: d1xksa_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1xksA (A:)
    gsmfphhsitesvnydvktfgsslpvkvmealtlaevddqltinideggwaclvckekli
    iwkialspitklsvckelqlppsdfhwsadlvalsysspsgeahstqavavmvatregsi
    rywpslagedtyteafvdsggdktysfltavqggsfilsssgsqlirlipessgkihqhi
    lpqgqgmlsgigrkvsslfgilspssdltlssvlwdrerssfysltssniskwelddsse
    khayswdinralkenitdaiwgsesnyeaikegvniryldlkqncdglvilaaawhsadn
    pcliyyslitiedngcqmsdavtvevtqynppfqsedlilcqltvpnfsnqtaylynesa
    vyvcstgtgkfslpqekivfnaqgdsvlgagacggvpiifsrnsglvsitsrenvsilae
    dlegslassvagpnsesmifetttknetia
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xksA (A:)
    esvnydvktfgsslpvkvmealtlaevddqltinideggwaclvckekliiwkialspit
    klsvckelqlppsdfhwsadlvalsysstqavavmvatregsirywpslagedtyteafv
    dktysfltavqggsfilsssgsqlirlipessgkihqhilpqgqgmsdltlssvlwdrer
    ssfysltssniskwelddssekhayswdinralkenitdaiwgsesnyeaikegvniryl
    dlkqncdglvilaaawhsadnpcliyyslitiedngcqmsdavtvevtqynppfqsedli
    lcqltvpnfsnqtaylynesavyvcstgtgkfslpqekivfnaqgdsvlgagacggvpii
    fsrnsglvsitsre