PDB entry 1xkr

View 1xkr on RCSB PDB site
Description: X-ray Structure of Thermotoga maritima CheC
Class: attractant
Keywords: chemotaxis, signal transduction, protein phosphatase, ATTRACTANT
Deposited on 2004-09-29, released 2004-12-07
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.75 Å
R-factor: 0.226
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: chemotaxis protein CheC
    Species: Thermotoga maritima [TaxId:2336]
    Database cross-references and differences (RAF-indexed):
    • GB NP_228712 (1-End)
      • linker (0)
    Domains in SCOPe 2.07: d1xkra_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1xkrA (A:)
    hmkiserqkdllkeignigagnaataisyminkkveisvpnveivpiskvifiakdpeei
    vvgvkmpvtgdiegsvllimgttvvkkileiltgrapdnllnldefsasalreignimcg
    tyvsaladflgfkidtlppqlvidmisaifaeasieelednsedqivfvetllkveeeee
    pltsymmmipkpgylvkifermgiqe
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xkrA (A:)
    hmkiserqkdllkeignigagnaataisyminkkveisvpnveivpiskvifiakdpeei
    vvgvkmpvtgdiegsvllimgttvvkkileiltgrapdnllnldefsasalreignimcg
    tyvsaladflgfkidtlppqlvidmisaifaeasieelednsedqivfvetllkveeeee
    pltsymmmipkpgylvkifermgiq