PDB entry 1xkq

View 1xkq on RCSB PDB site
Description: Crystal Structure of Short-Chain Dehydrogenase/Reductase of unknown Function from Caenorhabditis Elegans with Cofactor
Class: unknown function
Keywords: Parrallel beta-sheet of seven strands in the order 3214567; three alpha-helices on either side of beta-sheet; seventh alpha-helix on top of beta-sheet, Structural Genomics, PSI, Protein Structure Initiative, Southeast Collaboratory for Structural Genomics, SECSG, UNKNOWN FUNCTION
Deposited on 2004-09-29, released 2004-10-12
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.216
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: short-chain reductase family member (5D234)
    Species: Caenorhabditis elegans [TaxId:6239]
    Gene: R05D8.7
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1xkqa_
  • Chain 'B':
    Compound: short-chain reductase family member (5D234)
    Species: Caenorhabditis elegans [TaxId:6239]
    Gene: R05D8.7
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1xkqb_
  • Chain 'C':
    Compound: short-chain reductase family member (5D234)
    Species: Caenorhabditis elegans [TaxId:6239]
    Gene: R05D8.7
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1xkqc_
  • Chain 'D':
    Compound: short-chain reductase family member (5D234)
    Species: Caenorhabditis elegans [TaxId:6239]
    Gene: R05D8.7
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1xkqd_
  • Heterogens: NDP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1xkqA (A:)
    mprfsnktviitgssngigrttailfaqeganvtitgrsserleetrqiilksgvsekqv
    nsvvadvttedgqdqiinstlkqfgkidvlvnnagaaipdafgttgtdqgidiyhktlkl
    nlqaviemtkkvkphlvaskgeivnvssivagpqaqpdflyyaiakaaldqytrstaidl
    akfgirvnsvspgmvetgftnamgmpdqasqkfynfmashkecipigaagkpehianiil
    fladrnlsfyilgqsivadggtslvmgtqahdvmsimssh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xkqA (A:)
    prfsnktviitgssngigrttailfaqeganvtitgrsserleetrqiilksgvsekqvn
    svvadvttedgqdqiinstlkqfgkidvlvnnagaaipdafgttgtdqgidiyhktlkln
    lqaviemtkkvkphlvaskgeivnvssivagpqaqpdflyyaiakaaldqytrstaidla
    kfgirvnsvspgmvetgftnamgmpdqasqkfynfmashkecipigaagkpehianiilf
    ladrnlsfyilgqsivadggtslvmgtqahdv
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1xkqB (B:)
    mprfsnktviitgssngigrttailfaqeganvtitgrsserleetrqiilksgvsekqv
    nsvvadvttedgqdqiinstlkqfgkidvlvnnagaaipdafgttgtdqgidiyhktlkl
    nlqaviemtkkvkphlvaskgeivnvssivagpqaqpdflyyaiakaaldqytrstaidl
    akfgirvnsvspgmvetgftnamgmpdqasqkfynfmashkecipigaagkpehianiil
    fladrnlsfyilgqsivadggtslvmgtqahdvmsimssh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xkqB (B:)
    prfsnktviitgssngigrttailfaqeganvtitgrsserleetrqiilksgvsekqvn
    svvadvttedgqdqiinstlkqfgkidvlvnnagaaipdafgttgtdqgidiyhktlkln
    lqaviemtkkvkphlvaskgeivnvssivagpqaqpdflyyaiakaaldqytrstaidla
    kfgirvnsvspgmvetgftnamgmpdqasqkfynfmashkecipigaagkpehianiilf
    ladrnlsfyilgqsivadggtslvmgtqahd
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1xkqC (C:)
    mprfsnktviitgssngigrttailfaqeganvtitgrsserleetrqiilksgvsekqv
    nsvvadvttedgqdqiinstlkqfgkidvlvnnagaaipdafgttgtdqgidiyhktlkl
    nlqaviemtkkvkphlvaskgeivnvssivagpqaqpdflyyaiakaaldqytrstaidl
    akfgirvnsvspgmvetgftnamgmpdqasqkfynfmashkecipigaagkpehianiil
    fladrnlsfyilgqsivadggtslvmgtqahdvmsimssh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xkqC (C:)
    prfsnktviitgssngigrttailfaqeganvtitgrsserleetrqiilksgvsekqvn
    svvadvttedgqdqiinstlkqfgkidvlvnnagaaipdafgttgtdqgidiyhktlkln
    lqaviemtkkvkphlvaskgeivnvssivagpqaqpdflyyaiakaaldqytrstaidla
    kfgirvnsvspgmvetgftnamgmpdqasqkfynfmashkecipigaagkpehianiilf
    ladrnlsfyilgqsivadggtslvmgtqahd
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1xkqD (D:)
    mprfsnktviitgssngigrttailfaqeganvtitgrsserleetrqiilksgvsekqv
    nsvvadvttedgqdqiinstlkqfgkidvlvnnagaaipdafgttgtdqgidiyhktlkl
    nlqaviemtkkvkphlvaskgeivnvssivagpqaqpdflyyaiakaaldqytrstaidl
    akfgirvnsvspgmvetgftnamgmpdqasqkfynfmashkecipigaagkpehianiil
    fladrnlsfyilgqsivadggtslvmgtqahdvmsimssh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xkqD (D:)
    prfsnktviitgssngigrttailfaqeganvtitgrsserleetrqiilksgvsekqvn
    svvadvttedgqdqiinstlkqfgkidvlvnnagaaipdafgttgtdqgidiyhktlkln
    lqaviemtkkvkphlvaskgeivnvssivagpqaqpdflyyaiakaaldqytrstaidla
    kfgirvnsvspgmvetgftnamgmpdqasqkfynfmashkecipigaagkpehianiilf
    ladrnlsfyilgqsivadggtslvmgtqahd