PDB entry 1xko

View 1xko on RCSB PDB site
Description: Structure of Thermotoga maritima CheX
Class: attractant
Keywords: chemotaxis, signal transduction, protein phosphatase, ATTRACTANT
Deposited on 2004-09-29, released 2004-12-07
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.48 Å
R-factor: 0.24
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: CHEMOTAXIS protein cheX
    Species: Thermotoga maritima [TaxId:2336]
    Database cross-references and differences (RAF-indexed):
    • GB NP_229418 (4-End)
      • cloning artifact (3)
    Domains in SCOPe 2.07: d1xkoa1, d1xkoa2
  • Chain 'B':
    Compound: CHEMOTAXIS protein cheX
    Species: Thermotoga maritima [TaxId:2336]
    Database cross-references and differences (RAF-indexed):
    • GB NP_229418 (4-158)
      • cloning artifact (0-3)
    Domains in SCOPe 2.07: d1xkob1, d1xkob2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1xkoA (A:)
    gshmmdarivnaligsvyetirdvlgiepktgkpstvshieiphslvtvigitggiegsl
    iysfssetalkvvsammggmeynqldelalsaigelgnmtagklamklehlgkhvditpp
    tvvsgrdlkiksfgvilklpisvfseedfdlhlsvksgg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xkoA (A:)
    mmdarivnaligsvyetirdvlgiepktgkpstvshieiphslvtvigitggiegsliys
    fssetalkvvsammggmeynqldelalsaigelgnmtagklamklehhvditpptvvsgr
    dlkiksfgvilklpisvfseedfdlhlsvk
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1xkoB (B:)
    gshmmdarivnaligsvyetirdvlgiepktgkpstvshieiphslvtvigitggiegsl
    iysfssetalkvvsammggmeynqldelalsaigelgnmtagklamklehlgkhvditpp
    tvvsgrdlkiksfgvilklpisvfseedfdlhlsvksgg