PDB entry 1xkn

View 1xkn on RCSB PDB site
Description: crystal structure of the putative peptidyl-arginine deiminase from chlorobium tepidum, nesg target ctr21
Deposited on 2004-09-29, released 2004-11-16
The last revision prior to the SCOP 1.71 freeze date was dated 2004-11-16, with a file datestamp of 2004-11-16.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.18
AEROSPACI score: 0.58 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.71: d1xkna_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1xknA (A:)
    mseptyfmppewaphastwlswphkleswpgkfepvpavfaelayqlsrsetvninvldd
    ameaqarellkerdpegkyaerivfhriptndawcrdhgpnyvirtqdgrrdkvimnwey
    nawggkyepydddnavpervakaqglpmvstgmvleggaidvngagllltttacllnpnr
    npslgkaeieaqlrrylgiekvlwlgdgiagddtdghvddmarfvnentvviaveedped
    enykplrenyellktmtgldgkplnivklpmpepvyydgerlpasyanfyiantvvlvpt
    yrcprdqqaidilqqcfpkrevvgidcsdliwglgaihcvtheepamlehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xknA (A:)
    septyfmppewaphastwlswphkleswpgkfepvpavfaelayqlsrsetvninvldda
    meaqarellkerdpegkyaerivfhriptndawcrdhgpnyvirtqdgrrdkvimnweyn
    awggkyepydddnavpervakaqglpmvstgmvleggaidvngagllltttacllnpnrn
    pslgkaeieaqlrrylgiekvlwlgdgiagddtdghvddmarfvnentvviaveedpede
    nykplrenyellktmtgldgkplnivklpmpepvyydgerlpasyanfyiantvvlvpty
    rcprdqqaidilqqcfpkrevvgidcsdliwglgaihcvtheepamlehhhhh