PDB entry 1xkn

View 1xkn on RCSB PDB site
Description: Crystal Structure of the Putative Peptidyl-arginine Deiminase from Chlorobium tepidum, NESG Target CtR21
Class: structural genomics
Keywords: alpha-beta protein, NESG, Structural Genomics, Protein Structure Initiative, PSI, Northeast Structural Genomics Consortium
Deposited on 2004-09-29, released 2004-11-16
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: N/A
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: putative peptidyl-arginine deiminase
    Species: Chlorobaculum tepidum [TaxId:194439]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8KCB6 (Start-346)
      • modified residue (7)
      • modified residue (61)
      • modified residue (115)
      • modified residue (147)
      • modified residue (152)
      • modified residue (220)
      • modified residue (255)
      • modified residue (270)
      • modified residue (346)
      • expression tag (347-353)
    Domains in SCOPe 2.08: d1xkna1, d1xkna2
  • Heterogens: NA, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1xknA (A:)
    mseptyfmppewaphastwlswphkleswpgkfepvpavfaelayqlsrsetvninvldd
    ameaqarellkerdpegkyaerivfhriptndawcrdhgpnyvirtqdgrrdkvimnwey
    nawggkyepydddnavpervakaqglpmvstgmvleggaidvngagllltttacllnpnr
    npslgkaeieaqlrrylgiekvlwlgdgiagddtdghvddmarfvnentvviaveedped
    enykplrenyellktmtgldgkplnivklpmpepvyydgerlpasyanfyiantvvlvpt
    yrcprdqqaidilqqcfpkrevvgidcsdliwglgaihcvtheepamlehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xknA (A:)
    septyfmppewaphastwlswphkleswpgkfepvpavfaelayqlsrsetvninvldda
    meaqarellkerdpegkyaerivfhriptndawcrdhgpnyvirtqdgrrdkvimnweyn
    awggkyepydddnavpervakaqglpmvstgmvleggaidvngagllltttacllnpnrn
    pslgkaeieaqlrrylgiekvlwlgdgiagddtdghvddmarfvnentvviaveedpede
    nykplrenyellktmtgldgkplnivklpmpepvyydgerlpasyanfyiantvvlvpty
    rcprdqqaidilqqcfpkrevvgidcsdliwglgaihcvtheepamlehhhhh