PDB entry 1xkl

View 1xkl on RCSB PDB site
Description: crystal structure of salicylic acid-binding protein 2 (sabp2) from nicotiana tabacum, nesg target ar2241
Deposited on 2004-09-29, released 2004-11-30
The last revision prior to the SCOP 1.71 freeze date was dated 2004-11-30, with a file datestamp of 2004-11-30.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.19
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.71: d1xkla_
  • Chain 'B':
    Domains in SCOP 1.71: d1xklb_
  • Chain 'C':
    Domains in SCOP 1.71: d1xklc_
  • Chain 'D':
    Domains in SCOP 1.71: d1xkld_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1xklA (A:)
    mkegkhfvlvhgachggwswyklkplleaaghkvtaldlaasgtdlrkieelrtlydytl
    plmelmeslsadekvilvghslggmnlglamekypqkiyaavflaafmpdsvhnssfvle
    qynertpaenwldtqflpygspeepltsmffgpkflahklyqlcspedlalasslvrpss
    lfmedlskakyftderfgsvkrvyivctedkgipeefqrwqidnigvteaieikgadhma
    mlcepqklcaslleiahkynmagdplehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xklA (A:)
    egkhfvlvhgachggwswyklkplleaaghkvtaldlaasgtdlrkieelrtlydytlpl
    melmeslsadekvilvghslggmnlglamekypqkiyaavflaafmpdsvhnssfvleqy
    nertpaenwldtqflpygspeepltsmffgpkflahklyqlcspedlalasslvrpsslf
    medlskakyftderfgsvkrvyivctedkgipeefqrwqidnigvteaieikgadhmaml
    cepqklcaslleiahkyn
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1xklB (B:)
    mkegkhfvlvhgachggwswyklkplleaaghkvtaldlaasgtdlrkieelrtlydytl
    plmelmeslsadekvilvghslggmnlglamekypqkiyaavflaafmpdsvhnssfvle
    qynertpaenwldtqflpygspeepltsmffgpkflahklyqlcspedlalasslvrpss
    lfmedlskakyftderfgsvkrvyivctedkgipeefqrwqidnigvteaieikgadhma
    mlcepqklcaslleiahkynmagdplehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xklB (B:)
    egkhfvlvhgachggwswyklkplleaaghkvtaldlaasgtdlrkieelrtlydytlpl
    melmeslsadekvilvghslggmnlglamekypqkiyaavflaafmpdsvhnssfvleqy
    nertpaenwldtqflpygspeepltsmffgpkflahklyqlcspedlalasslvrpsslf
    medlskakyftderfgsvkrvyivctedkgipeefqrwqidnigvteaieikgadhmaml
    cepqklcaslleiahk
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1xklC (C:)
    mkegkhfvlvhgachggwswyklkplleaaghkvtaldlaasgtdlrkieelrtlydytl
    plmelmeslsadekvilvghslggmnlglamekypqkiyaavflaafmpdsvhnssfvle
    qynertpaenwldtqflpygspeepltsmffgpkflahklyqlcspedlalasslvrpss
    lfmedlskakyftderfgsvkrvyivctedkgipeefqrwqidnigvteaieikgadhma
    mlcepqklcaslleiahkynmagdplehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xklC (C:)
    egkhfvlvhgachggwswyklkplleaaghkvtaldlaasgtdlrkieelrtlydytlpl
    melmeslsadekvilvghslggmnlglamekypqkiyaavflaafmpdsvhnssfvleqy
    nertpaenwldtqflpygspeepltsmffgpkflahklyqlcspedlalasslvrpsslf
    medlskakyftderfgsvkrvyivctedkgipeefqrwqidnigvteaieikgadhmaml
    cepqklcaslleiahky
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1xklD (D:)
    mkegkhfvlvhgachggwswyklkplleaaghkvtaldlaasgtdlrkieelrtlydytl
    plmelmeslsadekvilvghslggmnlglamekypqkiyaavflaafmpdsvhnssfvle
    qynertpaenwldtqflpygspeepltsmffgpkflahklyqlcspedlalasslvrpss
    lfmedlskakyftderfgsvkrvyivctedkgipeefqrwqidnigvteaieikgadhma
    mlcepqklcaslleiahkynmagdplehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xklD (D:)
    egkhfvlvhgachggwswyklkplleaaghkvtaldlaasgtdlrkieelrtlydytlpl
    melmeslsadekvilvghslggmnlglamekypqkiyaavflaafmpdsvhnssfvleqy
    nertpaenwldtqflpygspeepltsmffgpkflahklyqlcspedlalasslvrpsslf
    medlskayftderfgsvkrvyivctedkgipeefqrwqidnigvteaieikgadhmamlc
    epqklcaslleiahkyn