PDB entry 1xkk

View 1xkk on RCSB PDB site
Description: EGFR kinase domain complexed with a quinazoline inhibitor- GW572016
Class: Transferase
Keywords: EGFR, epidermal growth factor receptor, kinase, Transferase
Deposited on 2004-09-29, released 2004-12-07
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.209
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Epidermal growth factor receptor
    Species: Homo sapiens [TaxId:9606]
    Gene: EGFR, ERBB1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1xkka_
  • Heterogens: PO4, FMM, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1xkkA (A:)
    mkkghhhhhhdydipttenlyfqgsgeapnqallrilketefkkikvlgsgafgtvykgl
    wipegekvkipvaikelreatspkankeildeayvmasvdnphvcrllgicltstvqlit
    qlmpfgclldyvrehkdnigsqyllnwcvqiakgmnyledrrlvhrdlaarnvlvktpqh
    vkitdfglakllgaeekeyhaeggkvpikwmalesilhriythqsdvwsygvtvwelmtf
    gskpydgipaseissilekgerlpqppictidvymimvkcwmidadsrpkfreliiefsk
    mardpqrylviqgdermhlpsptdsnfyralmdeedmddvvdadeylipqqg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xkkA (A:)
    allrilketefkkikvlgsgafgtvykglwipvkipvaikelrekankeildeayvmasv
    dnphvcrllgicltstvqlitqlmpfgclldyvrehkdnigsqyllnwcvqiakgmnyle
    drrlvhrdlaarnvlvktpqhvkitdfglakllgaeekvpikwmalesilhriythqsdv
    wsygvtvwelmtfgskpydgipaseissilekgerlpqppictidvymimvkcwmidads
    rpkfreliiefskmardpqrylviqgdermsnfyralmdevvdadeyli