PDB entry 1xki

View 1xki on RCSB PDB site
Description: Crystal structure of human tear lipocalin/von Ebners gland protein
Class: transport protein
Keywords: beta barrel, ligand binding protein, TRANSPORT PROTEIN
Deposited on 2004-09-29, released 2004-10-19
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.193
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Von Ebner's gland protein
    Species: Homo sapiens [TaxId:9606]
    Gene: LCN1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P31025
      • engineered (96)
    Domains in SCOPe 2.07: d1xkia_
  • Heterogens: ZN, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1xkiA (A:)
    asdeeiqdvsgtwylkamtvdrefpemnlesvtpmtlttleggnleakvtmlisgrcqev
    kavlektdepgkytadggkhvayiirshvkdhyifysegelhgkpvrgvklvgrdpknnl
    ealedfekaagarglstesiliprqsetcspgsawshpqfek
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xkiA (A:)
    dvsgtwylkamtvnlesvtpmtlttleggnleakvtmsgrcqevkavlektdepgkytad
    ggkhvayiirshvkdhyifysegegkpvrgvklvgrdpknnlealedfekaagarglste
    siliprqs