PDB entry 1xkh

View 1xkh on RCSB PDB site
Description: pyoverdine outer membrane receptor fpva from pseudomonas aeruginosa pao1 bound to pyoverdine
Deposited on 2004-09-29, released 2005-03-15
The last revision was dated 2015-04-22, with a file datestamp of 2015-04-17.
Experiment type: XRAY
Resolution: 3.6 Å
R-factor: N/A
AEROSPACI score: 0.05 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ferripyoverdine receptor
    Species: Pseudomonas aeruginosa [TaxId:287]
    Gene: fpva
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: Ferripyoverdine receptor
    Species: Pseudomonas aeruginosa [TaxId:287]
    Gene: fpva
    Database cross-references and differences (RAF-indexed):
  • Chain 'C':
    Compound: Ferripyoverdine receptor
    Species: Pseudomonas aeruginosa [TaxId:287]
    Gene: fpva
    Database cross-references and differences (RAF-indexed):
  • Chain 'I':
    Compound: Pyoverdin C-E
    Species: PSEUDOMONAS AERUGINOSA, synthetic [TaxId:287]
    Database cross-references and differences (RAF-indexed):
    • NOR NOR00190 (0-7)
  • Chain 'J':
    Compound: Pyoverdin C-E
    Species: PSEUDOMONAS AERUGINOSA, synthetic [TaxId:287]
    Database cross-references and differences (RAF-indexed):
    • NOR NOR00190 (0-7)
  • Chain 'K':
    Compound: Pyoverdin C-E
    Species: PSEUDOMONAS AERUGINOSA, synthetic [TaxId:287]
    Database cross-references and differences (RAF-indexed):
    • NOR NOR00190 (0-7)
  • Heterogens: SO4, PVE

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >1xkhA (A:)
    atmitsnqlgtitedsgsytpgtiatatrlvltpretpqsitvvtrqnmddfglnniddv
    mrhtpgitvsaydtdrnnyyargfsinnfqydgipstarnvgysagntlsdmaiydrvev
    lkgatglltgagslgatinlirkkpthefkghvelgagswdnyrseldvsgpltesgnvr
    gravaayqdkhsfmdhyerktsvyygilefdlnpdtmltvgadyqdndpkgsgwsgsfpl
    fdsqgnrndvsrsfnngakwssweqytrtvfanlehnfangwvgkvqldhkingyhaplg
    aimgdwpapdnsakivaqkytgetksnsldiyltgpfqflgrehelvvgtsasfshwegk
    sywnlrnydnttddfinwdgdigkpdwgtpsqyiddktrqlgsymtarfnvtddlnlflg
    grvvdyrvtglnptiresgrfipyvgavydlndtysvyasytdifmpqdswyrdssnkll
    epdegqnyeigikgeyldgrlntslayfeiheenraeedalynskptnpaityaykgika
    ktkgyeaeisgelapgwqvqagythkiirddsgkkvstwepqdqlslytsykfkgaldkl
    tvgggarwqgkswqmvynnprsrwekfsqedywlvdlmaryqitdklsasvnvnnvfdkt
    yytnigfytsasygdprnlmfstrwdf
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records:
    >1xkhB (B:)
    atmitsnqlgtitedsgsytpgtiatatrlvltpretpqsitvvtrqnmddfglnniddv
    mrhtpgitvsaydtdrnnyyargfsinnfqydgipstarnvgysagntlsdmaiydrvev
    lkgatglltgagslgatinlirkkpthefkghvelgagswdnyrseldvsgpltesgnvr
    gravaayqdkhsfmdhyerktsvyygilefdlnpdtmltvgadyqdndpkgsgwsgsfpl
    fdsqgnrndvsrsfnngakwssweqytrtvfanlehnfangwvgkvqldhkingyhaplg
    aimgdwpapdnsakivaqkytgetksnsldiyltgpfqflgrehelvvgtsasfshwegk
    sywnlrnydnttddfinwdgdigkpdwgtpsqyiddktrqlgsymtarfnvtddlnlflg
    grvvdyrvtglnptiresgrfipyvgavydlndtysvyasytdifmpqdswyrdssnkll
    epdegqnyeigikgeyldgrlntslayfeiheenraeedalynskptnpaityaykgika
    ktkgyeaeisgelapgwqvqagythkiirddsgkkvstwepqdqlslytsykfkgaldkl
    tvgggarwqgkswqmvynnprsrwekfsqedywlvdlmaryqitdklsasvnvnnvfdkt
    yytnigfytsasygdprnlmfstrwdf
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records:
    >1xkhC (C:)
    atmitsnqlgtitedsgsytpgtiatatrlvltpretpqsitvvtrqnmddfglnniddv
    mrhtpgitvsaydtdrnnyyargfsinnfqydgipstarnvgysagntlsdmaiydrvev
    lkgatglltgagslgatinlirkkpthefkghvelgagswdnyrseldvsgpltesgnvr
    gravaayqdkhsfmdhyerktsvyygilefdlnpdtmltvgadyqdndpkgsgwsgsfpl
    fdsqgnrndvsrsfnngakwssweqytrtvfanlehnfangwvgkvqldhkingyhaplg
    aimgdwpapdnsakivaqkytgetksnsldiyltgpfqflgrehelvvgtsasfshwegk
    sywnlrnydnttddfinwdgdigkpdwgtpsqyiddktrqlgsymtarfnvtddlnlflg
    grvvdyrvtglnptiresgrfipyvgavydlndtysvyasytdifmpqdswyrdssnkll
    epdegqnyeigikgeyldgrlntslayfeiheenraeedalynskptnpaityaykgika
    ktkgyeaeisgelapgwqvqagythkiirddsgkkvstwepqdqlslytsykfkgaldkl
    tvgggarwqgkswqmvynnprsrwekfsqedywlvdlmaryqitdklsasvnvnnvfdkt
    yytnigfytsasygdprnlmfstrwdf
    

  • Chain 'I':
    Sequence; same for both SEQRES and ATOM records:
    >1xkhI (I:)
    srsxkxtt
    

  • Chain 'J':
    Sequence; same for both SEQRES and ATOM records:
    >1xkhJ (J:)
    srsxkxtt
    

  • Chain 'K':
    Sequence; same for both SEQRES and ATOM records:
    >1xkhK (K:)
    srsxkxtt