PDB entry 1xkg

View 1xkg on RCSB PDB site
Description: Crystal structure of the major house dust mite allergen Der p 1 in its pro form at 1.61 A resolution
Class: hydrolase
Keywords: Major allergen, cysteine protease, house dust mite, Dermatophagoides pteronyssinus, inactive mutant, pro peptide, HYDROLASE
Deposited on 2004-09-29, released 2005-06-28
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 1.61 Å
R-factor: 0.154
AEROSPACI score: 0.61 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Major mite fecal allergen Der p 1
    Species: Dermatophagoides pteronyssinus [TaxId:6956]
    Gene: DERP1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P08176 (Start-301)
      • engineered (113)
      • engineered (131)
      • engineered (203)
      • expression tag (302-305)
    Domains in SCOPe 2.07: d1xkga1, d1xkga2
  • Heterogens: YT3, SO4, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1xkgA (A:)
    rpssiktfeeykkafnksyatfedeeaarknflesvkyvqsnggainhlsdlsldefknr
    flmsaeafehlktqfdlnaetnacsingnapaeidlrqmrtvtpirmqggcgsawafsgv
    aatesaylayrdqsldlaeqelvdcasqhgchgdtiprgieyiqhngvvqesyyryvare
    qscrrpnaqrfgisnycqiyppnankirealaqthsaiaviigikdldafrhydgrtiiq
    rdngyqpnyhavnivgysnaqgvdywivrnswdtnwgdngygyfaanidlmmieeypyvv
    ilgqtghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xkgA (A:)
    siktfeeykkafnksyatfedeeaarknflesvkyvqsnggainhlsdlsldefknrflm
    saeafehlktqfdnacsingnapaeidlrqmrtvtpirmqggcgsawafsgvaatesayl
    ayrdqsldlaeqelvdcasqhgchgdtiprgieyiqhngvvqesyyryvareqscrrpna
    qrfgisnycqiyppnankirealaqthsaiaviigikdldafrhydgrtiiqrdngyqpn
    yhavnivgysnaqgvdywivrnswdtnwgdngygyfaanidlmmieeypyvvilgqtg