PDB entry 1xke

View 1xke on RCSB PDB site
Description: Solution structure of the second Ran-binding domain from human RanBP2
Class: protein transport
Keywords: beta barrel, pleckstrin-homology (PH) domain, phosphotyrosine-binding (PTB) domain, PROTEIN TRANSPORT
Deposited on 2004-09-28, released 2005-04-19
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ran-binding protein 2
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P49792 (2-128)
      • cloning artifact (0-1)
      • cloning artifact (129)
    Domains in SCOPe 2.08: d1xkea1, d1xkea2, d1xkea3

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1xkeA (A:)
    gsgeedekvlysqrvklfrfdaevsqwkerglgnlkilknevngklrmlmrreqvlkvca
    nhwitttmnlkplsgsdrawmwlasdfsdgdakleqlaakfktpelaeefkqkfeecqrl
    lldiplqtpk