PDB entry 1xkd

View 1xkd on RCSB PDB site
Description: Ternary complex of Isocitrate dehydrogenase from the hyperthermophile Aeropyrum pernix
Class: oxidoreductase
Keywords: Enzyme, ternary complex, isocitrate, Ca2+, NADP+, OXIDOREDUCTASE
Deposited on 2004-09-28, released 2005-10-04
The last revision prior to the SCOPe 2.08 freeze date was dated 2018-03-07, with a file datestamp of 2018-03-02.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: N/A
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: isocitrate dehydrogenase
    Species: Aeropyrum pernix [TaxId:272557]
    Gene: BAA79665
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1xkda_
  • Chain 'B':
    Compound: isocitrate dehydrogenase
    Species: Aeropyrum pernix [TaxId:272557]
    Gene: BAA79665
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1xkdb_
  • Heterogens: CA, NAP, ICT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1xkdA (A:)
    mqvmasppctteelspppggslveysggslrvpdnpvvafirgdgvgpevvesalkvvda
    avkkvyggsrrivwwellaghlarekcgellpkatlegirlarvalkgpletpvgtgyrs
    lnvairqaldlyanirpvryygqpaphkyadrvdmvifrentedvyagiewphdspeaar
    irrflaeefgisiredagigvkpisrfatrrlmeralewalrngntvvtimhkgnimkyt
    egafmrwayevalekfrehvvteqevqekyggvrpegkilvndriadnmlqqiitrpwdy
    qvivapnlngdyisdaasalvggigmaagmnmgdgiavaepvhgtapkyagkdlinpsae
    ilsaslligefmgwrevksiveyairkavqskkvtqdlarhmpgvqplrtseytetliay
    ideadlnevlagkrg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xkdA (A:)
    asppctteelspppggslveysggslrvpdnpvvafirgdgvgpevvesalkvvdaavkk
    vyggsrrivwwellaghlarekcgellpkatlegirlarvalkgpletpvrslnvairqa
    ldlyanirpvryygqpaphkyadrvdmvifrentedvyagiewphdspeaarirrflaee
    fgisiredagigvkpisrfatrrlmeralewalrngntvvtimhkgnimkytegafmrwa
    yevalekfrehvvteqevqekyggvrpegkilvndriadnmlqqiitrpwdyqvivapnl
    ngdyisdaasalvggigmaagmnmgdgiavaepvhgtapkyagkdlinpsaeilsaslli
    gefmgwrevksiveyairkavqskkvtqdlarhmpgvqplrtseytetliayideadlne
    vlagkrg
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1xkdB (B:)
    mqvmasppctteelspppggslveysggslrvpdnpvvafirgdgvgpevvesalkvvda
    avkkvyggsrrivwwellaghlarekcgellpkatlegirlarvalkgpletpvgtgyrs
    lnvairqaldlyanirpvryygqpaphkyadrvdmvifrentedvyagiewphdspeaar
    irrflaeefgisiredagigvkpisrfatrrlmeralewalrngntvvtimhkgnimkyt
    egafmrwayevalekfrehvvteqevqekyggvrpegkilvndriadnmlqqiitrpwdy
    qvivapnlngdyisdaasalvggigmaagmnmgdgiavaepvhgtapkyagkdlinpsae
    ilsaslligefmgwrevksiveyairkavqskkvtqdlarhmpgvqplrtseytetliay
    ideadlnevlagkrg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xkdB (B:)
    sppctteelspppggslveysggslrvpdnpvvafirgdgvgpevvesalkvvdaavkkv
    gsrrivwwellaghlarekcgellpkatlegirlarvalkgpletpvgtgyrslnvairq
    aldlyanirpvryygqpaphkyadrvdmvifrentedvyagiewphdspeaarirrflae
    efgisiredagigvkpisrfatrrlmeralewalrngntvvtimhkgnimkytegafmrw
    ayevalekfrehvvteqevqekyggvrpegkilvndriadnmlqqiitrpwdyqvivapn
    lngdyisdaasalvggigmaagmnmgdgiavaepvhgtapkyagkdlinpsaeilsasll
    igefmgwrevksiveyairkavqskkvtqdlarhmpgvqplrtseytetliayideadl