PDB entry 1xk9

View 1xk9 on RCSB PDB site
Description: Pseudomanas exotoxin A in complex with the PJ34 inhibitor
Class: transferase
Keywords: toxin, ADP-ribosylation, inhibitor, TRANSFERASE
Deposited on 2004-09-28, released 2005-05-17
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.213
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: exotoxin a
    Species: Pseudomonas aeruginosa [TaxId:287]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P11439 (0-End)
      • engineered (8)
      • engineered (116)
    Domains in SCOPe 2.07: d1xk9a_
  • Chain 'B':
    Compound: exotoxin a
    Species: Pseudomonas aeruginosa [TaxId:287]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P11439 (0-End)
      • engineered (8)
      • engineered (116)
    Domains in SCOPe 2.07: d1xk9b_
  • Heterogens: P34, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1xk9A (A:)
    eflgdggdvsfstrgtqnwtverllqahrqleergyvfvgyhgtfleaaqsivfggvrar
    sqdldaiwrgfyiagdpalaygyaqdqepdargrirngallrvyvprsslpgfyrtsltl
    aapeaageverlighplplrldaitgpeeeggrletilgwplaertvvipsaiptdprnv
    ggdldpssipdkeqaisalpdyasqpgkppredlk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xk9A (A:)
    eflgdggdvsfstrgtqnwtverllqahrqleergyvfvgyhgtfleaaqsivfggvrar
    sqdldaiwrgfyiagdpalaygyaqdqepdargrirngallrvyvprsslpgfyrtsltl
    aapeaageverlighplplrldaitgpeeeggrletilgwplaertvvipsaiptdprnv
    ggdldpssipdkeqaisalpdyas
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1xk9B (B:)
    eflgdggdvsfstrgtqnwtverllqahrqleergyvfvgyhgtfleaaqsivfggvrar
    sqdldaiwrgfyiagdpalaygyaqdqepdargrirngallrvyvprsslpgfyrtsltl
    aapeaageverlighplplrldaitgpeeeggrletilgwplaertvvipsaiptdprnv
    ggdldpssipdkeqaisalpdyasqpgkppredlk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xk9B (B:)
    eflgdggdvsfstrgtqnwtverllqahrqleergyvfvgyhgtfleaaqsivfggvrar
    iwrgfyiagdpalaygyaqdqepdargrirngallrvyvprsslpgfyrtsltlaapeaa
    geverlighplplrldaitgpeeeggrletilgwplaertvvipsaiptdprnvggdldp
    ssipdkeqaisalpdyas