PDB entry 1xk8

View 1xk8 on RCSB PDB site
Description: Divalent cation tolerant protein CUTA from Homo sapiens O60888
Class: structural genomics, unknown function
Keywords: human, Homo sapiens, divalent cation tolerant protein CUTA, Structural Genomics, PSI, Protein Structure Initiative, Southeast Collaboratory for Structural Genomics, SECSG, unknown function
Deposited on 2004-09-27, released 2004-10-19
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: N/A
AEROSPACI score: 0.17 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Divalent cation tolerant protein CUTA
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1xk8a_
  • Chain 'B':
    Compound: Divalent cation tolerant protein CUTA
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1xk8b_
  • Chain 'C':
    Compound: Divalent cation tolerant protein CUTA
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1xk8c_
  • Chain 'D':
    Compound: Divalent cation tolerant protein CUTA
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1xk8d_
  • Chain 'E':
    Compound: Divalent cation tolerant protein CUTA
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1xk8e_
  • Chain 'F':
    Compound: Divalent cation tolerant protein CUTA
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1xk8f_
  • Heterogens: NA

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1xk8A (A:)
    mggshhhhhhgmasgspptqpspasdsgsgyvpgsvsaafvtcpnekvakeiaravvekr
    laacvnlipqitsiyewkgkieedsevlmmiktqsslvpaltdfvrsvhpyevaevialp
    veqgnfpylqwvrqvtesvsdsitvlp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xk8A (A:)
    yvpgsvsaafvtcpnekvakeiaravvekrlaacvnlipqitsiyewkgkieedsevlmm
    iktqsslvpaltdfvrsvhpyevaevialpveqgnfpylqwvrqvte
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1xk8B (B:)
    mggshhhhhhgmasgspptqpspasdsgsgyvpgsvsaafvtcpnekvakeiaravvekr
    laacvnlipqitsiyewkgkieedsevlmmiktqsslvpaltdfvrsvhpyevaevialp
    veqgnfpylqwvrqvtesvsdsitvlp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xk8B (B:)
    yvpgsvsaafvtcpnekvakeiaravvekrlaacvnlipqitsiyewkgkieedsevlmm
    iktqsslvpaltdfvrsvhpyevaevialpveqgnfpylqwvrqvte
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1xk8C (C:)
    mggshhhhhhgmasgspptqpspasdsgsgyvpgsvsaafvtcpnekvakeiaravvekr
    laacvnlipqitsiyewkgkieedsevlmmiktqsslvpaltdfvrsvhpyevaevialp
    veqgnfpylqwvrqvtesvsdsitvlp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xk8C (C:)
    yvpgsvsaafvtcpnekvakeiaravvekrlaacvnlipqitsiyewkgkieedsevlmm
    iktqsslvpaltdfvrsvhpyevaevialpveqgnfpylqwvrqvte
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1xk8D (D:)
    mggshhhhhhgmasgspptqpspasdsgsgyvpgsvsaafvtcpnekvakeiaravvekr
    laacvnlipqitsiyewkgkieedsevlmmiktqsslvpaltdfvrsvhpyevaevialp
    veqgnfpylqwvrqvtesvsdsitvlp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xk8D (D:)
    yvpgsvsaafvtcpnekvakeiaravvekrlaacvnlipqitsiyewkgkieedsevlmm
    iktqsslvpaltdfvrsvhpyevaevialpveqgnfpylqwvrqvtes
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1xk8E (E:)
    mggshhhhhhgmasgspptqpspasdsgsgyvpgsvsaafvtcpnekvakeiaravvekr
    laacvnlipqitsiyewkgkieedsevlmmiktqsslvpaltdfvrsvhpyevaevialp
    veqgnfpylqwvrqvtesvsdsitvlp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xk8E (E:)
    yvpgsvsaafvtcpnekvakeiaravvekrlaacvnlipqitsiyewkgkieedsevlmm
    iktqsslvpaltdfvrsvhpyevaevialpveqgnfpylqwvrqvte
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1xk8F (F:)
    mggshhhhhhgmasgspptqpspasdsgsgyvpgsvsaafvtcpnekvakeiaravvekr
    laacvnlipqitsiyewkgkieedsevlmmiktqsslvpaltdfvrsvhpyevaevialp
    veqgnfpylqwvrqvtesvsdsitvlp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xk8F (F:)
    yvpgsvsaafvtcpnekvakeiaravvekrlaacvnlipqitsiyewkgkieedsevlmm
    iktqsslvpaltdfvrsvhpyevaevialpveqgnfpylqwvrqvte