PDB entry 1xk7

View 1xk7 on RCSB PDB site
Description: Crystal Structure- C2 form- of Escherichia coli Crotonobetainyl-CoA: carnitine CoA transferase (CaiB)
Class: transferase
Keywords: CaiB, CoA transferase, Carnitine, Crotonobetainyl coA, Montreal-Kingston Bacterial Structural Genomics Initiative, BSGI, Structural Genomics, TRANSFERASE
Deposited on 2004-09-27, released 2005-03-15
The last revision prior to the SCOPe 2.06 freeze date was dated 2013-02-13, with a file datestamp of 2013-02-08.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.187
AEROSPACI score: 0.58 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Crotonobetainyl-CoA:carnitine CoA-transferase
    Species: Escherichia coli [TaxId:562]
    Gene: CaiB
    Database cross-references and differences (RAF-indexed):
    • Uniprot P31572 (3-407)
      • cloning artifact (1-2)
    Domains in SCOPe 2.06: d1xk7a2, d1xk7a3
  • Chain 'B':
    Compound: Crotonobetainyl-CoA:carnitine CoA-transferase
    Species: Escherichia coli [TaxId:562]
    Gene: CaiB
    Database cross-references and differences (RAF-indexed):
    • Uniprot P31572 (3-407)
      • cloning artifact (1-2)
    Domains in SCOPe 2.06: d1xk7b2, d1xk7b3
  • Chain 'C':
    Compound: Crotonobetainyl-CoA:carnitine CoA-transferase
    Species: Escherichia coli [TaxId:562]
    Gene: CaiB
    Database cross-references and differences (RAF-indexed):
    • Uniprot P31572 (3-407)
      • cloning artifact (1-2)
    Domains in SCOPe 2.06: d1xk7c2, d1xk7c3
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1xk7A (A:)
    gshmdhlpmpkfgplaglrvvfsgieiagpfagqmfaewgaeviwienvawadtirvqpn
    ypqlsrrnlhalslnifkdegreaflklmettdifieaskgpafarrgitdevlwqhnpk
    lviahlsgfgqygteeytnlpayntiaqafsgyliqngdvdqpmpafpytadyfsgltat
    taalaalhkvretgkgesidiamyevmlrmgqyfmmdyfnggemcprmskgkdpyyagcg
    lykcadgyivmelvgitqieecfkdiglahllgtpeipegtqlihriecpygplveekld
    awlathtiaevkerfaelniacakvltvpelesnpqyvaresitqwqtmdgrtckgpnim
    pkfknnpgqiwrgmpshgmdtaailknigysendiqelvskglakved
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xk7A (A:)
    shmdhlpmpkfgplaglrvvfsgieiagpfagqmfaewgaeviwienvawadtirvqpny
    pqlsrrnlhalslnifkdegreaflklmettdifieaskgpafarrgitdevlwqhnpkl
    viahlsgfgqygteeytnlpayntiaqafsgyliqngdvdqpmpafpytadyfsgltatt
    aalaalhkvretgkgesidiamyevmlrmgqyfmmdyfnggemcprmskgkdpyyagcgl
    ykcadgyivmelvgitqieecfkdiglahllgtpeipegtqlihriecpygplveeklda
    wlathtiaevkerfaelniacakvltvpelesnpqyvaresitqwqtmdgrtckgpnimp
    kfknnpgqiwrgmpshgmdtaailknigysendiqelvskglakved
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1xk7B (B:)
    gshmdhlpmpkfgplaglrvvfsgieiagpfagqmfaewgaeviwienvawadtirvqpn
    ypqlsrrnlhalslnifkdegreaflklmettdifieaskgpafarrgitdevlwqhnpk
    lviahlsgfgqygteeytnlpayntiaqafsgyliqngdvdqpmpafpytadyfsgltat
    taalaalhkvretgkgesidiamyevmlrmgqyfmmdyfnggemcprmskgkdpyyagcg
    lykcadgyivmelvgitqieecfkdiglahllgtpeipegtqlihriecpygplveekld
    awlathtiaevkerfaelniacakvltvpelesnpqyvaresitqwqtmdgrtckgpnim
    pkfknnpgqiwrgmpshgmdtaailknigysendiqelvskglakved
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xk7B (B:)
    shmdhlpmpkfgplaglrvvfsgieiagpfagqmfaewgaeviwienvawadtirvqpny
    pqlsrrnlhalslnifkdegreaflklmettdifieaskgpafarrgitdevlwqhnpkl
    viahlsgfgqygteeytnlpayntiaqafsgyliqngdvdqpmpafpytadyfsgltatt
    aalaalhkvretgkgesidiamyevmlrmgqyfmmdyfnggemcprmskgkdpyyagcgl
    ykcadgyivmelvgitqieecfkdiglahllgtpeipegtqlihriecpygplveeklda
    wlathtiaevkerfaelniacakvltvpelesnpqyvaresitqwqtmdgrtckgpnimp
    kfknnpgqiwrgmpshgmdtaailknigysendiqelvskglakved
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1xk7C (C:)
    gshmdhlpmpkfgplaglrvvfsgieiagpfagqmfaewgaeviwienvawadtirvqpn
    ypqlsrrnlhalslnifkdegreaflklmettdifieaskgpafarrgitdevlwqhnpk
    lviahlsgfgqygteeytnlpayntiaqafsgyliqngdvdqpmpafpytadyfsgltat
    taalaalhkvretgkgesidiamyevmlrmgqyfmmdyfnggemcprmskgkdpyyagcg
    lykcadgyivmelvgitqieecfkdiglahllgtpeipegtqlihriecpygplveekld
    awlathtiaevkerfaelniacakvltvpelesnpqyvaresitqwqtmdgrtckgpnim
    pkfknnpgqiwrgmpshgmdtaailknigysendiqelvskglakved
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xk7C (C:)
    shmdhlpmpkfgplaglrvvfsgieiagpfagqmfaewgaeviwienvawadtirvqpny
    pqlsrrnlhalslnifkdegreaflklmettdifieaskgpafarrgitdevlwqhnpkl
    viahlsgfgqygteeytnlpayntiaqafsgyliqngdvdqpmpafpytadyfsgltatt
    aalaalhkvretgkgesidiamyevmlrmgqyfmmdyfnggemcprmskgkdpyyagcgl
    ykcadgyivmelvgitqieecfkdiglahllgtpeipegtqlihriecpygplveeklda
    wlathtiaevkerfaelniacakvltvpelesnpqyvaresitqwqtmdgrtckgpnimp
    kfknnpgqiwrgmpshgmdtaailknigysendiqelvskglakved