PDB entry 1xk5

View 1xk5 on RCSB PDB site
Description: Crystal structure of the m3G-cap-binding domain of snurportin1 in complex with a m3GpppG-cap dinucleotide
Class: transport protein
Keywords: Protein-RNA-complex, TRANSPORT PROTEIN
Deposited on 2004-09-27, released 2005-06-07
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.227
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Snurportin-1
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1xk5a_
  • Heterogens: TPG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1xk5A (A:)
    hyanqlmlsewlidvpsdlgqewivvvcpvgkralivasrgstsaytksgycvnrfssll
    pggnrrnstakdytildciynevnqtyyvldvmcwrghpfydcqtdfrfywmhsklpeee
    glgektklnpfkfvglknfpctpeslcdvlsmdfpfevdgllfyhkqthyspgstplvgw
    lrpymvsdvlgvavpagplttkpd