PDB entry 1xk4

View 1xk4 on RCSB PDB site
Description: Crystal structure of human calprotectin(S100A8/S100A9)
Class: metal binding protein
Keywords: S100 family, heterotetramer, METAL BINDING PROTEIN
Deposited on 2004-09-26, released 2005-10-18
The last revision prior to the SCOPe 2.06 freeze date was dated 2015-02-25, with a file datestamp of 2015-02-20.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.16
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Calgranulin A
    Species: Homo sapiens [TaxId:9606]
    Gene: S100A8
    Database cross-references and differences (RAF-indexed):
    • Uniprot P05109 (0-End)
      • engineered mutation (41)
    Domains in SCOPe 2.06: d1xk4a1
  • Chain 'B':
    Compound: Calgranulin A
    Species: Homo sapiens [TaxId:9606]
    Gene: S100A8
    Database cross-references and differences (RAF-indexed):
    • Uniprot P05109 (0-End)
      • engineered mutation (41)
    Domains in SCOPe 2.06: d1xk4b_
  • Chain 'C':
    Compound: Calgranulin B
    Species: Homo sapiens [TaxId:9606]
    Gene: S100A9
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1xk4c_
  • Chain 'D':
    Compound: Calgranulin B
    Species: Homo sapiens [TaxId:9606]
    Gene: S100A9
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1xk4d_
  • Chain 'E':
    Compound: Calgranulin A
    Species: Homo sapiens [TaxId:9606]
    Gene: S100A8
    Database cross-references and differences (RAF-indexed):
    • Uniprot P05109 (0-End)
      • engineered mutation (41)
    Domains in SCOPe 2.06: d1xk4e_
  • Chain 'F':
    Compound: Calgranulin A
    Species: Homo sapiens [TaxId:9606]
    Gene: S100A8
    Database cross-references and differences (RAF-indexed):
    • Uniprot P05109 (0-End)
      • engineered mutation (41)
    Domains in SCOPe 2.06: d1xk4f_
  • Chain 'G':
    Compound: Calgranulin B
    Species: Homo sapiens [TaxId:9606]
    Gene: S100A9
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1xk4g_
  • Chain 'H':
    Compound: Calgranulin B
    Species: Homo sapiens [TaxId:9606]
    Gene: S100A9
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1xk4h_
  • Chain 'I':
    Compound: Calgranulin A
    Species: Homo sapiens [TaxId:9606]
    Gene: S100A8
    Database cross-references and differences (RAF-indexed):
    • Uniprot P05109 (0-End)
      • engineered mutation (41)
    Domains in SCOPe 2.06: d1xk4i_
  • Chain 'J':
    Compound: Calgranulin A
    Species: Homo sapiens [TaxId:9606]
    Gene: S100A8
    Database cross-references and differences (RAF-indexed):
    • Uniprot P05109 (0-End)
      • engineered mutation (41)
    Domains in SCOPe 2.06: d1xk4j_
  • Chain 'K':
    Compound: Calgranulin B
    Species: Homo sapiens [TaxId:9606]
    Gene: S100A9
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1xk4k_
  • Chain 'L':
    Compound: Calgranulin B
    Species: Homo sapiens [TaxId:9606]
    Gene: S100A9
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1xk4l_
  • Heterogens: CA, CL, FLC, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1xk4A (A:)
    mltelekalnsiidvyhkyslikgnfhavyrddlkklletespqyirkkgadvwfkeldi
    ntdgavnfqeflilvikmgvaahkksheeshke
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xk4A (A:)
    mltelekalnsiidvyhkyslikgnfhavyrddlkklletespqyirkkgadvwfkeldi
    ntdgavnfqeflilvikmgvaahkksh
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1xk4B (B:)
    mltelekalnsiidvyhkyslikgnfhavyrddlkklletespqyirkkgadvwfkeldi
    ntdgavnfqeflilvikmgvaahkksheeshke
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xk4B (B:)
    mltelekalnsiidvyhkyslikgnfhavyrddlkklletespqyirkkgadvwfkeldi
    ntdgavnfqeflilvikmgvaahkkshe
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1xk4C (C:)
    tskmsqlernietiintfhqysvklghpdtlnqgefkelvrkdlqnflkkenknekvieh
    imedldtnadkqlsfeefimlmarltwashekmhegdegpghhhkpglgegtp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xk4C (C:)
    kmsqlernietiintfhqysvklghpdtlnqgefkelvrkdlqnflkkenknekviehim
    edldtnadkqlsfeefimlmarltwashe
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1xk4D (D:)
    tskmsqlernietiintfhqysvklghpdtlnqgefkelvrkdlqnflkkenknekvieh
    imedldtnadkqlsfeefimlmarltwashekmhegdegpghhhkpglgegtp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xk4D (D:)
    kmsqlernietiintfhqysvklghpdtlnqgefkelvrkdlqnflkkenknekviehim
    edldtnadkqlsfeefimlmarltwashekmh
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1xk4E (E:)
    mltelekalnsiidvyhkyslikgnfhavyrddlkklletespqyirkkgadvwfkeldi
    ntdgavnfqeflilvikmgvaahkksheeshke
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xk4E (E:)
    mltelekalnsiidvyhkyslikgnfhavyrddlkklletespqyirkkgadvwfkeldi
    ntdgavnfqeflilvikmgvaahkkshee
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1xk4F (F:)
    mltelekalnsiidvyhkyslikgnfhavyrddlkklletespqyirkkgadvwfkeldi
    ntdgavnfqeflilvikmgvaahkksheeshke
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xk4F (F:)
    mltelekalnsiidvyhkyslikgnfhavyrddlkklletespqyirkkgadvwfkeldi
    ntdgavnfqeflilvikmgvaahkksh
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >1xk4G (G:)
    tskmsqlernietiintfhqysvklghpdtlnqgefkelvrkdlqnflkkenknekvieh
    imedldtnadkqlsfeefimlmarltwashekmhegdegpghhhkpglgegtp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xk4G (G:)
    kmsqlernietiintfhqysvklghpdtlnqgefkelvrkdlqnflkkenknekviehim
    edldtnadkqlsfeefimlmarltwashekmh
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >1xk4H (H:)
    tskmsqlernietiintfhqysvklghpdtlnqgefkelvrkdlqnflkkenknekvieh
    imedldtnadkqlsfeefimlmarltwashekmhegdegpghhhkpglgegtp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xk4H (H:)
    kmsqlernietiintfhqysvklghpdtlnqgefkelvrkdlqnflkkenknekviehim
    edldtnadkqlsfeefimlmarltwashe
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >1xk4I (I:)
    mltelekalnsiidvyhkyslikgnfhavyrddlkklletespqyirkkgadvwfkeldi
    ntdgavnfqeflilvikmgvaahkksheeshke
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xk4I (I:)
    mltelekalnsiidvyhkyslikgnfhavyrddlkklletespqyirkkgadvwfkeldi
    ntdgavnfqeflilvikmgvaahkksh
    

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >1xk4J (J:)
    mltelekalnsiidvyhkyslikgnfhavyrddlkklletespqyirkkgadvwfkeldi
    ntdgavnfqeflilvikmgvaahkksheeshke
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xk4J (J:)
    mltelekalnsiidvyhkyslikgnfhavyrddlkklletespqyirkkgadvwfkeldi
    ntdgavnfqeflilvikmgvaahkkshe
    

  • Chain 'K':
    Sequence, based on SEQRES records: (download)
    >1xk4K (K:)
    tskmsqlernietiintfhqysvklghpdtlnqgefkelvrkdlqnflkkenknekvieh
    imedldtnadkqlsfeefimlmarltwashekmhegdegpghhhkpglgegtp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xk4K (K:)
    kmsqlernietiintfhqysvklghpdtlnqgefkelvrkdlqnflkkenknekviehim
    edldtnadkqlsfeefimlmarltwashekmh
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >1xk4L (L:)
    tskmsqlernietiintfhqysvklghpdtlnqgefkelvrkdlqnflkkenknekvieh
    imedldtnadkqlsfeefimlmarltwashekmhegdegpghhhkpglgegtp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xk4L (L:)
    kmsqlernietiintfhqysvklghpdtlnqgefkelvrkdlqnflkkenknekviehim
    edldtnadkqlsfeefimlmarltwashekmh