PDB entry 1xk2

View 1xk2 on RCSB PDB site
Description: NADPH- and Ascorbate-Supported Heme Oxygenase Reactions are Distinct. Regiospecificity of Heme Cleavage by the R183E Mutant
Class: oxidoreductase
Keywords: heme, heme degradation, catalytic mechanism, OXIDOREDUCTASE
Deposited on 2004-09-26, released 2004-11-09
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.22
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Heme oxygenase 1
    Species: Homo sapiens [TaxId:9606]
    Gene: HMOX1, HO1, HO
    Database cross-references and differences (RAF-indexed):
    • Uniprot P09601
      • engineered (182)
    Domains in SCOPe 2.07: d1xk2a_
  • Chain 'B':
    Compound: Heme oxygenase 1
    Species: Homo sapiens [TaxId:9606]
    Gene: HMOX1, HO1, HO
    Database cross-references and differences (RAF-indexed):
    • Uniprot P09601
      • engineered (182)
    Domains in SCOPe 2.07: d1xk2b_
  • Heterogens: HEM, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1xk2A (A:)
    merpqpdsmpqdlsealkeatkevhtqaenaefmrnfqkgqvtrdgfklvmaslyhiyva
    leeeiernkespvfapvyfpeelhrkaaleqdlafwygprwqevipytpamqryvkrlhe
    vgrtepellvahaytrylgdlsggqvlkkiaqkaldlpssgeglafftfpniasatkfkq
    lyesrmnslemtpavrqrvieeaktafllniqlfeelqellthdtkdqspsra
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xk2A (A:)
    pqdlsealkeatkevhtqaenaefmrnfqkgqvtrdgfklvmaslyhiyvaleeeiernk
    espvfapvyfpeelhrkaaleqdlafwygprwqevipytpamqryvkrlhevgrtepell
    vahaytrylgdlsggqvlkkiaqkaldlpssgeglafftfpniasatkfkqlyesrmnsl
    emtpavrqrvieeaktafllniqlfeelqellth
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1xk2B (B:)
    merpqpdsmpqdlsealkeatkevhtqaenaefmrnfqkgqvtrdgfklvmaslyhiyva
    leeeiernkespvfapvyfpeelhrkaaleqdlafwygprwqevipytpamqryvkrlhe
    vgrtepellvahaytrylgdlsggqvlkkiaqkaldlpssgeglafftfpniasatkfkq
    lyesrmnslemtpavrqrvieeaktafllniqlfeelqellthdtkdqspsra
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xk2B (B:)
    pqdlsealkeatkevhtqaenaefmrnfqkgqvtrdgfklvmaslyhiyvaleeeiernk
    espvfapvyfpeelhrkaaleqdlafwygprwqevipytpamqryvkrlhevgrtepell
    vahaytrylgdlsggqvlkkiaqkaldlpssgeglafftfpniasatkfkqlyesrmnsl
    emtpavrqrvieeaktafllniqlfeelqellth