PDB entry 1xjv

View 1xjv on RCSB PDB site
Description: Crystal structure of human POT1 bound to telomeric single-stranded DNA (TTAGGGTTAG)
Class: transcription/DNA
Keywords: telomere; protein-DNA complex; single-stranded DNA, TRANSCRIPTION/DNA COMPLEX
Deposited on 2004-09-25, released 2004-12-14
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-19.
Experiment type: XRAY
Resolution: 1.73 Å
R-factor: 0.228
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Protection of telomeres 1
    Species: Homo sapiens [TaxId:9606]
    Gene: POT1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1xjva1, d1xjva2
  • Chain 'B':
    Compound: hT10 d(TTAGGGTTAG)
    Species: synthetic, synthetic
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1xjvA (A:)
    atnyiytplnqlkggtivnvygvvkffkppylskgtdycsvvtivdqtnvkltcllfsgn
    yealpiiykngdivrfhrlkiqvykketqgitssgfasltfegtlgapiiprtsskyfnf
    ttedhkmvealrvwasthmspswtllklcdvqpmqyfdltcqllgkaevdgasfllkvwd
    gtrtpfpswrvliqdlvlegdlshihrlqnltidilvydnhvhvarslkvgsflriyslh
    tklqsmnsenqtmlslefhlhggtsygrgirvlpesnsdvdqlkkdlesanlta
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xjvA (A:)
    atnyiytplnqlkggtivnvygvvkffkppylskgtdycsvvtivdqtnvkltcllfsgn
    yealpiiykngdivrfhrlkiqvykketqgitssgfasltfegtlgapiiprtsskyfnf
    ttedhkmvealrvwasthmstllklcdvqpmqyfdltcqllgkaevdgasfllkvwdgtr
    tpfpswrvliqdlvlegdlshihrlqnltidilvydnhvhvarslkvgsflriyslhtkl
    qsmnsenqtmlslefhlhggtsygrgirvlpesnsdvdqlkkdlesanlta
    

  • Chain 'B':
    No sequence available.