PDB entry 1xjs

View 1xjs on RCSB PDB site
Description: Solution structure of Iron-Sulfur cluster assembly protein IscU from Bacillus subtilis, with Zinc bound at the active site. Northeast Structural Genomics Consortium Target SR17
Class: structural genomics, unknown function
Keywords: SR17, NMR Structure, Autostructure, Iron-Sulfur, Zinc, Northeast Structural Genomics Consortium, NESG, NIFU-LIKE, Protein Structure Initiative, Structural Genomics, PSI, UNKNOWN FUNCTION
Deposited on 2004-09-24, released 2005-01-04
The last revision prior to the SCOPe 2.03 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: NifU-like protein
    Species: Bacillus subtilis [TaxId:1423]
    Gene: nifU
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d1xjsa_
  • Heterogens: ZN

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1xjsA (A:)
    msfnanldtlyrqvimdhyknprnkgvlndsivvdmnnptcgdrirltmkldgdivedak
    fegegcsismasasmmtqaikgkdietalsmskifsdmmqgkeyddsidlgdiealqgvs
    kfparikcatlswkalekgvakeeggn