PDB entry 1xjq

View 1xjq on RCSB PDB site
Description: ADP Complex OF HUMAN PAPS SYNTHETASE 1
Class: transferase
Keywords: transferase, ATP sulfurylase, aps kinase, paps, phosphoadenosine phosphosulfate
Deposited on 2004-09-24, released 2005-08-30
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 2.06 Å
R-factor: N/A
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Bifunctional 3'-phosphoadenosine 5'-phosphosulfate synthetase 1
    Species: Homo sapiens [TaxId:9606]
    Gene: PAPSS1, PAPSS, ATPSK1
    Database cross-references and differences (RAF-indexed):
    • Uniprot O43252 (Start-623)
      • conflict (415)
    Domains in SCOPe 2.08: d1xjqa1, d1xjqa2, d1xjqa3
  • Chain 'B':
    Compound: Bifunctional 3'-phosphoadenosine 5'-phosphosulfate synthetase 1
    Species: Homo sapiens [TaxId:9606]
    Gene: PAPSS1, PAPSS, ATPSK1
    Database cross-references and differences (RAF-indexed):
    • Uniprot O43252
      • conflict (415)
    Domains in SCOPe 2.08: d1xjqb1, d1xjqb2, d1xjqb3
  • Heterogens: ADP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1xjqA (A:)
    meipgslckkvklsnnaqnwgmqratnvtyqahhvsrnkrgqvvgtrggfrgctvwltgl
    sgagkttvsmaleeylvchgipcytldgdnirqglnknlgfspedreenvrriaevaklf
    adaglvcitsfispytqdrnnarqihegaslpffevfvdaplhvceqrdvkglykkarag
    eikgftgidseyekpeapelvlktdscdvndcvqqvvellqerdivpvdasyevkelyvp
    enklhlaktdaetlpalkinkvdmqwvqvlaegwatplngfmrereylqclhfdclldgg
    vinlsvpivltathedkerldgctafalmyegrrvailrnpeffehrkeercarqwgttc
    knhpyikmvmeqgdwliggdlqvldrvywndgldqyrltptelkqkfkdmnadavsafql
    rnpvhnghallmqdthkqllergyrrpvlllhplggwtkdddvplmwrmkqhaavleegv
    lnpettvvaifpspmmyagptevqwhcrarmvaganfyivgrdpagmphpetgkdlyeps
    hgakvltmapglitleivpfrvaaynkkkkrmdyydsehhedfefisgtrmrklaregqk
    ppegfmapkawtvlteyykslekahhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xjqA (A:)
    hvsrnkrgqvvgtrggfrgctvwltglsgagkttvsmaleeylvchgipcytldgdnirq
    glnknlgfspedreenvrriaevaklfadaglvcitsfispytqdrnnarqihegaslpf
    fevfvdapleyekpeapelvlktdscdvndcvqqvvellqerdivpvdasyevkelyvpe
    nklhlaktdaetlpalkinkvdmqwvqvlaegwatplngfmrereylqclhfdclldggv
    inlsvpivltathedkerldgctafalmyegrrvailrnpeffehrkeercarqwgttck
    nhpyikmvmeqgdwliggdlqvldrvywndgldqyrltptelkqkfkdmnadavsafqlr
    npvhnghallmqdthkqllergyrrpvlllhplggwtkdddvplmwrmkqhaavleegvl
    npettvvaifpspmmyagptevqwhcrarmvaganfyivgrdpagmphpetgkdlyepsh
    gakvltmapglitleivpfrvaaynkkkkrmdyydsehhedfefisgtrmrklaregqkp
    pegfmapkawtvlteyyksleka
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1xjqB (B:)
    meipgslckkvklsnnaqnwgmqratnvtyqahhvsrnkrgqvvgtrggfrgctvwltgl
    sgagkttvsmaleeylvchgipcytldgdnirqglnknlgfspedreenvrriaevaklf
    adaglvcitsfispytqdrnnarqihegaslpffevfvdaplhvceqrdvkglykkarag
    eikgftgidseyekpeapelvlktdscdvndcvqqvvellqerdivpvdasyevkelyvp
    enklhlaktdaetlpalkinkvdmqwvqvlaegwatplngfmrereylqclhfdclldgg
    vinlsvpivltathedkerldgctafalmyegrrvailrnpeffehrkeercarqwgttc
    knhpyikmvmeqgdwliggdlqvldrvywndgldqyrltptelkqkfkdmnadavsafql
    rnpvhnghallmqdthkqllergyrrpvlllhplggwtkdddvplmwrmkqhaavleegv
    lnpettvvaifpspmmyagptevqwhcrarmvaganfyivgrdpagmphpetgkdlyeps
    hgakvltmapglitleivpfrvaaynkkkkrmdyydsehhedfefisgtrmrklaregqk
    ppegfmapkawtvlteyykslekahhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xjqB (B:)
    hvsrnkrgqvvgtrggfrgctvwltglsgagkttvsmaleeylvchgipcytldgdnirq
    glnknlgfspedreenvrriaevaklfadaglvcitsfispytqdrnnarqihegaslpf
    fevfvdaplhvceqrdvkglykkarageikgftgidseyekpeapelvlktdscdvndcv
    qqvvellqerdivpvdasyevkelyvpenklhlaktdaetlpalkinkvdmqwvqvlaeg
    watplngfmrereylqclhfdclldggvinlsvpivltathedkerldgctafalmyegr
    rvailrnpeffehrkeercarqwgttcknhpyikmvmeqgdwliggdlqvldrvywndgl
    dqyrltptelkqkfkdmnadavsafqlrnpvhnghallmqdthkqllergyrrpvlllhp
    lggwtkdddvplmwrmkqhaavleegvlnpettvvaifpspmmyagptevqwhcrarmva
    ganfyivgrdpagmphpetgkdlyepshgakvltmapglitleivpfrvaaynkkkkrmd
    yydsehhedfefisgtrmrklaregqkppegfmapkawtvlteyykslek