PDB entry 1xjo

View 1xjo on RCSB PDB site
Description: structure of aminopeptidase
Class: hydrolase
Keywords: hydrolase, aminopeptidase, zymogen, zinc
Deposited on 1996-10-09, released 1997-04-01
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.75 Å
R-factor: 0.141
AEROSPACI score: 0.56 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: aminopeptidase
    Species: Streptomyces griseus [TaxId:1911]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P80561 (0-End)
      • modified residue (160)
    Domains in SCOPe 2.07: d1xjoa_
  • Heterogens: ZN, PO4, CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1xjoA (A:)
    apdiplanvkahltqlstiaannggnrahgrpgykasvdyvkakldaagytttlqqftsg
    gatgynlianwpggdpnkvlmagahldsvssgagindngsgsaavletalavsragyqpd
    khlrfawwgaeelgligskfyvnnlpsadrsklagylnfdmigspnpgyfvydddpviek
    tfknyfaglnvpteietegdgrsdhapfknvgvpvgglftgagytksaaqaqkwggtagq
    afdrcyhsscdslsnindtaldrnsdaaahaiwtlssgtgeppt
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xjoA (A:)
    apdiplanvkahltqlstiaannggnrahgrpgykasvdyvkakldaagytttlqqftsg
    gatgynlianwpggdpnkvlmagahldsvssgagindngsgsaavletalavsragyqpd
    khlrfawwgaeelgligskfyvnnlpsadrsklagylnfdmigspnpgyfvydddpviek
    tfknyfaglnvpteirsdhapfknvgvpvgglftgagytksaaqaqkwggtagqafdrcy
    hsscdslsnindtaldrnsdaaahaiwtlss