PDB entry 1xjk

View 1xjk on RCSB PDB site
Description: structural mechanism of allosteric substrate specificity in a ribonucleotide reductase: dgtp-adp complex
Deposited on 2004-09-23, released 2005-11-22
The last revision was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 2.12 Å
R-factor: N/A
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ribonucleotide reductase, B12-dependent
    Species: Thermotoga maritima [TaxId:2336]
    Gene: nrdj
    Database cross-references and differences (RAF-indexed):
    • Uniprot O33839 (0-End)
      • see remark 999 (204)
      • conflict (518)
  • Chain 'B':
    Compound: ribonucleotide reductase, B12-dependent
    Species: Thermotoga maritima [TaxId:2336]
    Gene: nrdj
    Database cross-references and differences (RAF-indexed):
  • Heterogens: MG, ADP, DGT, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >1xjkA (A:)
    mklsdlisrwidvepsknaqiilrdryfmkdldgnyletkwedvarrvarvvataellnp
    sykknekldrikewediffrvlkarlfipnsptlfnaglgvkhdllwkpidqmtledyee
    iyrsrnhlhmlsacfvvpvgdsieeifeavkeyalitkvgggvgsnfselrpkgsfvagt
    hgkasgpvsfmhvfnsaisvvkqgsrrrgalmgilninhpdieefidakkentgeavlnf
    fnlsvgfpmdkkeilklyeedgelelshprstirkkvkirelfrkiatnawksgdpglaf
    lgemnkyyplyphrkinstnpcgeiglsdyeacnlgsidvakfynngfvdlealqelvqi
    avrfldnvidvnvfpidkitkavkesrrlglgimgfadllykleipynsqeardfaanlm
    afialhahrtsyelgkekgnfplleisryrtednfvpfamgmsnyddeirevmkmtkefr
    rnvalltiaptgsisniadtssglepnfllaytrfvtkddgtkepllyvnqvlreklnpe
    ilkriekeliekgslkdipdvpekikkvfvvaldidpmdhllmqdafqryvdnnisktin
    mpqsatvddvlnvylealrtnvrgitvyrdgslqtqvltkalkt
    

    Sequence, based on observed residues (ATOM records):
    >1xjkA (A:)
    mklsdlisrwidvepsknaqiilrdryfmkdldgnyletkwedvarrvarvvataellnp
    sykknekldrikewediffrvlkarlfipnsptlfnaglgvkhdllwkpidqmtledyee
    iyrsrnhlhmlsacfvvpvgdsieeifeavkeyalitkvgggvgsnfselrpkgsfvagt
    hgkasgpvsfmhvfnsaisvvkqgsalmgilninhpdieefidakkevlnffnlsvgfpm
    dkkeilklyeedgelelshprstirkkvkirelfrkiatnawksgdpglaflgemnkyyp
    lyphrkinstnpcgeiglsdyeacnlgsidvakfynngfvdlealqelvqiavrfldnvi
    dvnvfpidkitkavkesrrlglgimgfadllykleipynsqeardfaanlmafialhahr
    tsyelgkekgnfplleisryrtednfvpfamgmsnyddeirevmkmtkefrrnvalltia
    ptgsisniadtssglepnfllaytrfvtkddgtkepllyvnqvlreklnpeilkriekel
    iekgslkdipdvpekikkvfvvaldidpmdhllmqdafqryvdnnisktinmpqsatvdd
    vlnvylealrtnvrgitvyrdgsl
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >1xjkB (B:)
    mklsdlisrwidvepsknaqiilrdryfmkdldgnyletkwedvarrvarvvataellnp
    sykknekldrikewediffrvlkarlfipnsptlfnaglgvkhdllwkpidqmtledyee
    iyrsrnhlhmlsacfvvpvgdsieeifeavkeyalitkvgggvgsnfselrpkgsfvagt
    hgkasgpvsfmhvfnsaisvvkqgsrrrgalmgilninhpdieefidakkentgeavlnf
    fnlsvgfpmdkkeilklyeedgelelshprstirkkvkirelfrkiatnawksgdpglaf
    lgemnkyyplyphrkinstnpcgeiglsdyeacnlgsidvakfynngfvdlealqelvqi
    avrfldnvidvnvfpidkitkavkesrrlglgimgfadllykleipynsqeardfaanlm
    afialhahrtsyelgkekgnfplleisryrtednfvpfamgmsnyddeirevmkmtkefr
    rnvalltiaptgsisniadtssglepnfllaytrfvtkddgtkepllyvnqvlreklnpe
    ilkriekeliekgslkdipdvpekikkvfvvaldidpmdhllmqdafqryvdnnisktin
    mpqsatvddvlnvylealrtnvrgitvyrdgslqtqvltkalkt
    

    Sequence, based on observed residues (ATOM records):
    >1xjkB (B:)
    mklsdlisrwidvepsknaqiilrdryfmkdldgnyletkwedvarrvarvvataellnp
    sykknekldrikewediffrvlkarlfipnsptlfnaglgvkhdllwkpidqmtledyee
    iyrsrnhlhmlsacfvvpvgdsieeifeavkeyalitkvgggvgsnfselrpkgsfvagt
    hgkasgpvsfmhvfnsaisvvkqalmgilninhpdieefidakkeavlnffnlsvgfpmd
    kkeilklyeedgelelshprstirkkvkirelfrkiatnawksgdpglaflgemnkyypl
    yphrkinstnpcgeiglsdyeacnlgsidvakfynngfvdlealqelvqiavrfldnvid
    vnvfpidkitkavkesrrlglgimgfadllykleipynsqeardfaanlmafialhahrt
    syelgkekgnfplleisryrtednfvpfamgmsnyddeirevmkmtkefrrnvalltiap
    tgsisniadtssglepnfllaytrvnqvlreklnpeilkriekeliekgslkdipdvpek
    ikkvfvvaldidpmdhllmqdafqryvdnnisktinmpqsatvddvlnvylealrtnvrg
    itvyrdgs