PDB entry 1xjj

View 1xjj on RCSB PDB site
Description: structural mechanism of allosteric substrate specificity in a ribonucleotide reductase: dgtp complex
Deposited on 2004-09-23, released 2005-12-20
The last revision was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 1.86 Å
R-factor: N/A
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ribonucleotide reductase, B12-dependent
    Species: Thermotoga maritima [TaxId:2336]
    Gene: nrdj
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: ribonucleotide reductase, B12-dependent
    Species: Thermotoga maritima [TaxId:2336]
    Gene: nrdj
    Database cross-references and differences (RAF-indexed):
  • Heterogens: MG, DGT, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >1xjjA (A:)
    mklsdlisrwidvepsknaqiilrdryfmkdldgnyletkwedvarrvarvvataellnp
    sykknekldrikewediffrvlkarlfipnsptlfnaglgvkhdllwkpidqmtledyee
    iyrsrnhlhmlsacfvvpvgdsieeifeavkeyalitkvgggvgsnfselrpkgsfvagt
    hgkasgpvsfmhvfnsaisvvkqgsrrrgalmgilninhpdieefidakkentgeavlnf
    fnlsvgfpmdkkeilklyeedgelelshprstirkkvkirelfrkiatnawksgdpglaf
    lgemnkyyplyphrkinstnpcgeiglsdyeacnlgsidvakfynngfvdlealqelvqi
    avrfldnvidvnvfpidkitkavkesrrlglgimgfadllykleipynsqeardfaanlm
    afialhahrtsyelgkekgnfplleisryrtednfvpfamgmsnyddeirevmkmtkefr
    rnvalltiaptgsisniadtssglepnfllaytrfvtkedgtkepllyvnqvlreklnpe
    ilkriekeliekgslkdipdvpekikkvfvvaldidpmdhllmqdafqryvdnnisktin
    mpqsatvddvlnvylealrtnvrgitvyrdgslqtqvltkalkt
    

    Sequence, based on observed residues (ATOM records):
    >1xjjA (A:)
    mklsdlisrwidvepsknaqiilrdryfmkdldgnyletkwedvarrvarvvataellnp
    sykknekldrikewediffrvlkarlfipnsptlfnaglgvkhdllwkpidqmtledyee
    iyrsrnhlhmlsacfvvpvgdsieeifeavkeyalitkvgggvgsnfselrpkgsfvagt
    hgkasgpvsfmhvfnsaisvvkqalmgilninhpdieefidakkenvlnffnlsvgfpmd
    kkeilklyeedgelelshprstirkkvkirelfrkiatnawksgdpglaflgemnkyypl
    yphrkinstnpcgeiglsdyeacnlgsidvakfynngfvdlealqelvqiavrfldnvid
    vnvfpidkitkavkesrrlglgimgfadllykleipynsqeardfaanlmafialhahrt
    syelgkekgnfplleisryrtednfvpfamgmsnyddeirevmkmtkefrrnvalltiap
    tgsisniadtssglepnfllaytrfvtkedgtkepllyvnqvlreklnpeilkriekeli
    ekgslkdipdvpekikkvfvvaldidpmdhllmqdafqryvdnnisktinmpqsatvddv
    lnvylealrtnvrgitvyrdgsl
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >1xjjB (B:)
    mklsdlisrwidvepsknaqiilrdryfmkdldgnyletkwedvarrvarvvataellnp
    sykknekldrikewediffrvlkarlfipnsptlfnaglgvkhdllwkpidqmtledyee
    iyrsrnhlhmlsacfvvpvgdsieeifeavkeyalitkvgggvgsnfselrpkgsfvagt
    hgkasgpvsfmhvfnsaisvvkqgsrrrgalmgilninhpdieefidakkentgeavlnf
    fnlsvgfpmdkkeilklyeedgelelshprstirkkvkirelfrkiatnawksgdpglaf
    lgemnkyyplyphrkinstnpcgeiglsdyeacnlgsidvakfynngfvdlealqelvqi
    avrfldnvidvnvfpidkitkavkesrrlglgimgfadllykleipynsqeardfaanlm
    afialhahrtsyelgkekgnfplleisryrtednfvpfamgmsnyddeirevmkmtkefr
    rnvalltiaptgsisniadtssglepnfllaytrfvtkedgtkepllyvnqvlreklnpe
    ilkriekeliekgslkdipdvpekikkvfvvaldidpmdhllmqdafqryvdnnisktin
    mpqsatvddvlnvylealrtnvrgitvyrdgslqtqvltkalkt
    

    Sequence, based on observed residues (ATOM records):
    >1xjjB (B:)
    mklsdlisrwidvepsknaqiilrdryfmkdldgnyletkwedvarrvarvvataellnp
    sykknekldrikewediffrvlkarlfipnsptlfnaglgvkhdllwkpidqmtledyee
    iyrsrnhlhmlsacfvvpvgdsieeifeavkeyalitkvgggvgsnfselrpkgsfvagt
    hgkasgpvsfmhvfnsaisvvkqalmgilninhpdieefidakkeavlnffnlsvgfpmd
    kkeilklyeedgelelshprstirkkvkirelfrkiatnawksgdpglaflgemnkyypl
    yphrkinstnpcgeiglsdyeacnlgsidvakfynngfvdlealqelvqiavrfldnvid
    vnvfpidkitkavkesrrlglgimgfadllykleipynsqeardfaanlmafialhahrt
    syelgkekgnfplleisryrtednfvpfamgmsnyddeirevmkmtkefrrnvalltiap
    tgsisniadtssglepnfllaytrfyvnqvlreklnpeilkriekeliekgslkdipdvp
    ekikkvfvvaldidpmdhllmqdafqryvdnnisktinmpqsatvddvlnvylealrtnv
    rgitvyrdgsl