PDB entry 1xji

View 1xji on RCSB PDB site
Description: Bacteriorhodopsin crystallized in bicelles at room temperature
Class: membrane protein
Keywords: membrane protein bacteriorhodopsin
Deposited on 2004-09-23, released 2005-04-19
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.226
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: bacteriorhodopsin
    Species: Halobacterium salinarum [TaxId:2242]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1xjia_
  • Heterogens: RET, D12, D10, C14, OCT, CPS, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1xjiA (A:)
    aqitgrpewiwlalgtalmglgtlyflvkgmgvsdpdakkfyaittlvpaiaftmylsml
    lgygltmvpfggeqnpiywaryadwlfttplllldlallvdadqgtilalvgadgimigt
    glvgaltkvysyrfvwwaistaamlyilyvlffgftskaesmrpevastfkvlrnvtvvl
    wsaypvvwligsegagivplnietllfmvldvsakvgfglillrsraifgeaeapepsag
    dgaaats
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xjiA (A:)
    grpewiwlalgtalmglgtlyflvkgmgvsdpdakkfyaittlvpaiaftmylsmllgyg
    ltmvpfggeqnpiywaryadwlfttplllldlallvdadqgtilalvgadgimigtglvg
    altkvysyrfvwwaistaamlyilyvlffgftskaesmrpevastfkvlrnvtvvlwsay
    pvvwligsegagivplnietllfmvldvsakvgfglillrsraif