PDB entry 1xjh

View 1xjh on RCSB PDB site
Description: NMR structure of the redox switch domain of the E. coli Hsp33
Class: chaperone
Keywords: redox-switch domain, zinc-binding domain, four cysteins coordinating zinc, chaperone
Deposited on 2004-09-23, released 2004-10-05
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.05 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 33 kda chaperonin
    Species: Escherichia coli [TaxId:562]
    Gene: HSLO
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A6Y5 (1-61)
      • initiating methionine (0)
    Domains in SCOPe 2.08: d1xjha_
  • Heterogens: ZN

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1xjhA (A:)
    mdvefkctcsrercadalktlpdeevdsilaedgeidmhcdycgnhylfnamdiaeirnn
    as