PDB entry 1xjd

View 1xjd on RCSB PDB site
Description: Crystal Structure of PKC-theta complexed with Staurosporine at 2A resolution
Class: transferase
Keywords: KINASE, PKC-theta, ATP, AMP,, TRANSFERASE
Deposited on 2004-09-23, released 2004-10-19
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.201
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Protein kinase C, theta type
    Species: Homo sapiens [TaxId:9606]
    Gene: PKC
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q04759
      • modified residue (176)
      • modified residue (333)
    Domains in SCOPe 2.05: d1xjda_
  • Heterogens: STU, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1xjdA (A:)
    pelnkerpslqiklkiedfilhkmlgkgsfgkvflaefkktnqffaikalkkdvvlmddd
    vectmvekrvlslawehpflthmfctfqtkenlffvmeylnggdlmyhiqschkfdlsra
    tfyaaeiilglqflhskgivyrdlkldnilldkdghikiadfgmckenmlgdaktntfcg
    tpdyiapeillgqkynhsvdwwsfgvllyemligqspfhgqdeeelfhsirmdnpfyprw
    lekeakdllvklfvrepekrlgvrgdirqhplfreinweelerkeidppfrpkvkspfdc
    snfdkeflnekprlsfadralinsmdqnmfrnfsfmnpgmerlis
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xjdA (A:)
    iedfilhkmlgkgsfgkvflaefkktnqffaikalkkdvvlmdddvectmvekrvlslaw
    ehpflthmfctfqtkenlffvmeylnggdlmyhiqschkfdlsratfyaaeiilglqflh
    skgivyrdlkldnilldkdghikiadfgmckenmlgdaktntfcgtpdyiapeillgqky
    nhsvdwwsfgvllyemligqspfhgqdeeelfhsirmdnpfyprwlekeakdllvklfvr
    epekrlgvrgdirqhplfreinweelerkeidpqnmfrnfsf