PDB entry 1xjc

View 1xjc on RCSB PDB site
Description: X-ray crystal structure of MobB protein homolog from Bacillus stearothermophilus
Class: structural genomics, unknown function
Keywords: structural genomics, MobB, Midwest Center for Structural Genomics, PSI, Protein Structure Initiative, MCSG
Deposited on 2004-09-23, released 2004-11-09
The last revision prior to the SCOP 1.73 freeze date was dated 2005-01-18, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.196
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: MobB protein homolog
    Species: Bacillus stearothermophilus
    Gene: RBSTP0958
    Domains in SCOP 1.73: d1xjca_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >1xjcA (A:)
snamnvwqvvgykhsgkttlmekwvaaavregwrvgtvkhhghggeparpegvdsvrher
agavatavegdgllqlhlrrplwrlddvlalyaplrldlvlvegykqerhpkvvlvrsee
dwaslqhlaniraviaweplegplahpvfsladddeyipwlmnevrtrt

    Sequence, based on observed residues (ATOM records): (download) 
    >1xjcA (A:)
mnvwqvvgykhsgkttlmekwvaaavregwrvgtvkhhgavatavegdgllqlhlrrplw
rlddvlalyaplrldlvlvegykqerhpkvvlvrseedwaslqhlaniraviaweplegp
lahpvfsladddeyipwlmnevrtr