PDB entry 1xjb

View 1xjb on RCSB PDB site
Description: Crystal structure of human type 3 3alpha-hydroxysteroid dehydrogenase in complex with NADP(H), citrate and acetate molecules
Class: oxidoreductase
Keywords: human 3alphaHDS3; ALDO-KETO REDUCTASE; NADP; INDUCE-FIT MECANISM, OXIDOREDUCTASE
Deposited on 2004-09-23, released 2005-06-21
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.175
AEROSPACI score: 0.5 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Aldo-keto reductase family 1 member C2
    Species: Homo sapiens [TaxId:9606]
    Gene: AKR1C2, DDH2
    Database cross-references and differences (RAF-indexed):
    • Uniprot P52895 (3-324)
      • cloning artifact (0-2)
    Domains in SCOPe 2.07: d1xjba2, d1xjba3
  • Chain 'B':
    Compound: Aldo-keto reductase family 1 member C2
    Species: Homo sapiens [TaxId:9606]
    Gene: AKR1C2, DDH2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1xjbb_
  • Heterogens: ACT, SO4, NAP, EDO, CIT, BME, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1xjbA (A:)
    svddskyqcvklndghfmpvlgfgtyapaevpkskaleavklaieagfhhidsahvynne
    eqvglairskiadgsvkredifytsklwsnshrpelvrpalerslknlqldyvdlylihf
    pvsvkpgeevipkdengkilfdtvdlcatweamekckdaglaksigvsnfnhrllemiln
    kpglkykpvcnqvechpyfnqrklldfckskdivlvaysalgshreepwvdpnspvlled
    pvlcalakkhkrtpalialryqlqrgvvvlaksyneqrirqnvqvfefqltseemkaidg
    lnrnvryltldifagppnypfsdey
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1xjbB (B:)
    svddskyqcvklndghfmpvlgfgtyapaevpkskaleavklaieagfhhidsahvynne
    eqvglairskiadgsvkredifytsklwsnshrpelvrpalerslknlqldyvdlylihf
    pvsvkpgeevipkdengkilfdtvdlcatweamekckdaglaksigvsnfnhrllemiln
    kpglkykpvcnqvechpyfnqrklldfckskdivlvaysalgshreepwvdpnspvlled
    pvlcalakkhkrtpalialryqlqrgvvvlaksyneqrirqnvqvfefqltseemkaidg
    lnrnvryltldifagppnypfsdey
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xjbB (B:)
    dskyqcvklndghfmpvlgfgtyapaevpkskaleavklaieagfhhidsahvynneeqv
    glairskiadgsvkredifytsklwsnshrpelvrpalerslknlqldyvdlylihfpvs
    vkpgeevipkdengkilfdtvdlcatweamekckdaglaksigvsnfnhrllemilnkpg
    lkykpvcnqvechpyfnqrklldfckskdivlvaysalgshreepwvdpnspvlledpvl
    calakkhkrtpalialryqlqrgvvvlaksyneqrirqnvqvfefqltseemkaidglnr
    nvryltldifagppnypfsdey