PDB entry 1xja

View 1xja on RCSB PDB site
Description: Apo form of the Y31V mutant dimerization domain fragment of Escherichia coli regulatory protein AraC
Class: transcription
Keywords: Transcription factor, Coiled-coil, Jelly roll, Allostery, Arabinose, Carbohydrate binding, AraC, TRANSCRIPTION
Deposited on 2004-09-23, released 2004-10-12
The last revision prior to the SCOPe 2.06 freeze date was dated 2010-02-16, with a file datestamp of 2010-02-12.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.211
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: arabinose operon regulatory protein
    Species: Escherichia coli [TaxId:562]
    Gene: ARAC
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A9E0
      • engineered (30)
    Domains in SCOPe 2.06: d1xjaa_
  • Chain 'B':
    Compound: arabinose operon regulatory protein
    Species: Escherichia coli [TaxId:562]
    Gene: ARAC
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A9E0
      • engineered (30)
    Domains in SCOPe 2.06: d1xjab_
  • Chain 'C':
    Compound: arabinose operon regulatory protein
    Species: Escherichia coli [TaxId:562]
    Gene: ARAC
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A9E0
      • engineered (30)
    Domains in SCOPe 2.06: d1xjac_
  • Chain 'D':
    Compound: arabinose operon regulatory protein
    Species: Escherichia coli [TaxId:562]
    Gene: ARAC
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A9E0
      • engineered (30)
    Domains in SCOPe 2.06: d1xjad_
  • Chain 'E':
    Compound: arabinose operon regulatory protein
    Species: Escherichia coli [TaxId:562]
    Gene: ARAC
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A9E0
      • engineered (30)
    Domains in SCOPe 2.06: d1xjae_
  • Heterogens: EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1xjaA (A:)
    maeaqndpllpgysfnahlvagltpieangvldffidrplgmkgyilnltirgqgvvknq
    grefvcrpgdillfppgeihhygrhpearewyhqwvyfrpraywhewlnwpsifantgff
    rpdeahqphfsdlfgqiinagqgegrysellainlleqlllrrmeaineslhppmdnr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xjaA (A:)
    pllpgysfnahlvagltpieangvldffidrplgmkgyilnltirgqgvvknqgrefvcr
    pgdillfppgeihhygrhpearewyhqwvyfrpraywhewlnwpsifantgffrpdeahq
    phfsdlfgqiinagqgegrysellainlleqlllrrmeaineslh
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1xjaB (B:)
    maeaqndpllpgysfnahlvagltpieangvldffidrplgmkgyilnltirgqgvvknq
    grefvcrpgdillfppgeihhygrhpearewyhqwvyfrpraywhewlnwpsifantgff
    rpdeahqphfsdlfgqiinagqgegrysellainlleqlllrrmeaineslhppmdnr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xjaB (B:)
    fnahlvagltpieangvldffidrplgmkgyilnltirgqgvvknqgrefvcrpgdillf
    ppgeihhygrhpearewyhqwvyfrpraywhewlnwpsifantgffrpdeahqphfsdlf
    gqiinagqgegrysellainlleqlllrrmeain
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1xjaC (C:)
    maeaqndpllpgysfnahlvagltpieangvldffidrplgmkgyilnltirgqgvvknq
    grefvcrpgdillfppgeihhygrhpearewyhqwvyfrpraywhewlnwpsifantgff
    rpdeahqphfsdlfgqiinagqgegrysellainlleqlllrrmeaineslhppmdnr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xjaC (C:)
    dpllpgysfnahlvagltpieangvldffidrplgmkgyilnltirgqgvvknqgrefvc
    rpgdillfppgeihhygrhpearewyhqwvyfrpraywhewlnwpsifantgffrpdeah
    qphfsdlfgqiinagqgegrysellainlleqlllrrmeaineslhppm
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1xjaD (D:)
    maeaqndpllpgysfnahlvagltpieangvldffidrplgmkgyilnltirgqgvvknq
    grefvcrpgdillfppgeihhygrhpearewyhqwvyfrpraywhewlnwpsifantgff
    rpdeahqphfsdlfgqiinagqgegrysellainlleqlllrrmeaineslhppmdnr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xjaD (D:)
    dpllpgysfnahlvagltpieangvldffidrplgmkgyilnltirgqgvvknqgrefvc
    rpgdillfppgeihhygrhpearewyhqwvyfrpraywhewlnwpsifantgffrpdeah
    qphfsdlfgqiinagqgegrysellainlleqlllrrmeainesl
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1xjaE (E:)
    maeaqndpllpgysfnahlvagltpieangvldffidrplgmkgyilnltirgqgvvknq
    grefvcrpgdillfppgeihhygrhpearewyhqwvyfrpraywhewlnwpsifantgff
    rpdeahqphfsdlfgqiinagqgegrysellainlleqlllrrmeaineslhppmdnr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xjaE (E:)
    dpllpgysfnahlvagltpieangvldffidrplgmkgyilnltirgqgvvknqgrefvc
    rpgdillfppgeihhygrhpearewyhqwvyfrpraywhewlnwpsifantgffrpdeah
    qphfsdlfgqiinagqgegrysellainlleqlllrrmeaine