PDB entry 1xja

View 1xja on RCSB PDB site
Description: Apo form of the Y31V mutant dimerization domain fragment of Escherichia coli regulatory protein AraC
Deposited on 2004-09-23, released 2004-10-12
The last revision prior to the SCOP 1.71 freeze date was dated 2004-10-12, with a file datestamp of 2004-10-12.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.211
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.71: d1xjaa_
  • Chain 'B':
    Domains in SCOP 1.71: d1xjab_
  • Chain 'C':
    Domains in SCOP 1.71: d1xjac_
  • Chain 'D':
    Domains in SCOP 1.71: d1xjad_
  • Chain 'E':
    Domains in SCOP 1.71: d1xjae_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1xjaA (A:)
    maeaqndpllpgysfnahlvagltpieangvldffidrplgmkgyilnltirgqgvvknq
    grefvcrpgdillfppgeihhygrhpearewyhqwvyfrpraywhewlnwpsifantgff
    rpdeahqphfsdlfgqiinagqgegrysellainlleqlllrrmeaineslhppmdnr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xjaA (A:)
    pllpgysfnahlvagltpieangvldffidrplgmkgyilnltirgqgvvknqgrefvcr
    pgdillfppgeihhygrhpearewyhqwvyfrpraywhewlnwpsifantgffrpdeahq
    phfsdlfgqiinagqgegrysellainlleqlllrrmeaineslh
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1xjaB (B:)
    maeaqndpllpgysfnahlvagltpieangvldffidrplgmkgyilnltirgqgvvknq
    grefvcrpgdillfppgeihhygrhpearewyhqwvyfrpraywhewlnwpsifantgff
    rpdeahqphfsdlfgqiinagqgegrysellainlleqlllrrmeaineslhppmdnr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xjaB (B:)
    fnahlvagltpieangvldffidrplgmkgyilnltirgqgvvknqgrefvcrpgdillf
    ppgeihhygrhpearewyhqwvyfrpraywhewlnwpsifantgffrpdeahqphfsdlf
    gqiinagqgegrysellainlleqlllrrmeain
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1xjaC (C:)
    maeaqndpllpgysfnahlvagltpieangvldffidrplgmkgyilnltirgqgvvknq
    grefvcrpgdillfppgeihhygrhpearewyhqwvyfrpraywhewlnwpsifantgff
    rpdeahqphfsdlfgqiinagqgegrysellainlleqlllrrmeaineslhppmdnr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xjaC (C:)
    dpllpgysfnahlvagltpieangvldffidrplgmkgyilnltirgqgvvknqgrefvc
    rpgdillfppgeihhygrhpearewyhqwvyfrpraywhewlnwpsifantgffrpdeah
    qphfsdlfgqiinagqgegrysellainlleqlllrrmeaineslhppm
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1xjaD (D:)
    maeaqndpllpgysfnahlvagltpieangvldffidrplgmkgyilnltirgqgvvknq
    grefvcrpgdillfppgeihhygrhpearewyhqwvyfrpraywhewlnwpsifantgff
    rpdeahqphfsdlfgqiinagqgegrysellainlleqlllrrmeaineslhppmdnr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xjaD (D:)
    dpllpgysfnahlvagltpieangvldffidrplgmkgyilnltirgqgvvknqgrefvc
    rpgdillfppgeihhygrhpearewyhqwvyfrpraywhewlnwpsifantgffrpdeah
    qphfsdlfgqiinagqgegrysellainlleqlllrrmeainesl
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1xjaE (E:)
    maeaqndpllpgysfnahlvagltpieangvldffidrplgmkgyilnltirgqgvvknq
    grefvcrpgdillfppgeihhygrhpearewyhqwvyfrpraywhewlnwpsifantgff
    rpdeahqphfsdlfgqiinagqgegrysellainlleqlllrrmeaineslhppmdnr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xjaE (E:)
    dpllpgysfnahlvagltpieangvldffidrplgmkgyilnltirgqgvvknqgrefvc
    rpgdillfppgeihhygrhpearewyhqwvyfrpraywhewlnwpsifantgffrpdeah
    qphfsdlfgqiinagqgegrysellainlleqlllrrmeaine