PDB entry 1xj6

View 1xj6 on RCSB PDB site
Description: Structure of bjFixLH in the unliganded ferrous form
Class: signaling protein, transferase
Keywords: PAS domain; heme; oxygen sensor, SIGNALING PROTEIN, TRANSFERASE
Deposited on 2004-09-22, released 2005-03-29
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-11-16, with a file datestamp of 2011-11-11.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.207
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: sensor protein fixl
    Species: BRADYRHIZOBIUM JAPONICUM [TaxId:375]
    Gene: fixL
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1xj6a_
  • Chain 'B':
    Compound: sensor protein fixl
    Species: BRADYRHIZOBIUM JAPONICUM [TaxId:375]
    Gene: fixL
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1xj6b_
  • Heterogens: CL, NA, HEM, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1xj6A (A:)
    tipdamividghgiiqlfstaaerlfgwseleaigqnvnilmpepdrsrhdsyisryrtt
    sdphiigigrivtgkrrdgttfpmhlsigemqsggepyftgfvrdltehqqtqarlqel
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xj6A (A:)
    pdamividghgiiqlfstaaerlfgwseleaigqnvnilmpepdrsrhdsyisryrttsd
    phiigigrivtgkrrdgttfpmhlsigemqsggepyftgfvrdlt
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1xj6B (B:)
    tipdamividghgiiqlfstaaerlfgwseleaigqnvnilmpepdrsrhdsyisryrtt
    sdphiigigrivtgkrrdgttfpmhlsigemqsggepyftgfvrdltehqqtqarlqel
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xj6B (B:)
    tipdamividghgiiqlfstaaerlfgwseleaigqnvnilmpepdrsrhdsyisryrtt
    sdphiigigrivtgkrrdgttfpmhlsigemqsggepyftgfvrdlt