PDB entry 1xj2

View 1xj2 on RCSB PDB site
Description: CO-bound structure of bjFixLH
Class: signaling protein, transferase
Keywords: PAS domain; heme; oxygen sensor; carbon monoxide, SIGNALING PROTEIN, TRANSFERASE
Deposited on 2004-09-22, released 2005-03-29
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.212
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: sensor protein fixl
    Species: BRADYRHIZOBIUM JAPONICUM [TaxId:375]
    Gene: fixL
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1xj2a_
  • Heterogens: HEM, CMO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1xj2A (A:)
    damividghgiiqlfstaaerlfgwseleaigqnvnilmpepdrsrhdsyisryrttsdp
    hiigigrivtgkrrdgttfpmhlsigemqsggepyftgfvrdltehqqtqarlqel