PDB entry 1xj2

View 1xj2 on RCSB PDB site
Description: CO-bound structure of bjFixLH
Class: signaling protein, transferase
Keywords: PAS domain; heme; oxygen sensor; carbon monoxide, SIGNALING PROTEIN, TRANSFERASE
Deposited on 2004-09-22, released 2005-03-29
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.212
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: sensor protein fixl
  Species: BRADYRHIZOBIUM JAPONICUM [TaxId:375]
  Gene: fixL
  Database cross-references and differences (RAF-indexed):
  • Uniprot P23222 (0-115)
  Domains in SCOPe 2.08: d1xj2a_
• Heterogens: HEM, CMO, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1xj2A (A:)
  damividghgiiqlfstaaerlfgwseleaigqnvnilmpepdrsrhdsyisryrttsdp
  hiigigrivtgkrrdgttfpmhlsigemqsggepyftgfvrdltehqqtqarlqel