PDB entry 1xj1

View 1xj1 on RCSB PDB site
Description: 3D solution structure of the C-terminal cysteine-rich domain of the VHv1.1 polydnaviral gene product
Class: Viral protein
Keywords: polydnavirus, cystine knot, cys-motif, beta-sheet structure, disulfide bonding patterns, Viral protein
Deposited on 2004-09-22, released 2004-10-05
The last revision prior to the SCOPe 2.02 freeze date was dated 2011-08-10, with a file datestamp of 2011-08-05.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cysteine-rich omega-conotoxin homolog VHv1.1
    Species: Campoletis sonorensis ichnovirus [TaxId:10484]
    Gene: pVX900
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.02: d1xj1a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1xj1A (A:)
    amvsstcighyqkcvnadkpccsktvrygdsknvrkficdrdgegvcvpfdggvrglpng
    a
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xj1A (A:)
    tcighyqkcvnadkpccsktvrygdsknvrkficdrdgegvcvpfdg