PDB entry 1xj1

View 1xj1 on RCSB PDB site
Description: 3D solution structure of the C-terminal cysteine-rich domain of the VHv1.1 polydnaviral gene product
Class: Viral protein
Keywords: polydnavirus, cystine knot, cys-motif, beta-sheet structure, disulfide bonding patterns
Deposited on 2004-09-22, released 2004-10-05
The last revision prior to the SCOP 1.73 freeze date was dated 2004-10-05, with a file datestamp of 2007-06-04.
Experiment type: NMR25
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: cysteine-rich omega-conotoxin homolog VHv1.1
  Species: Campoletis sonorensis virus
  Gene: pVX900
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q89632
  Domains in SCOP 1.73: d1xj1a_

PDB Chain Sequences:

• Chain 'A':
  Sequence, based on SEQRES records: (download)
  

  >1xj1A (A:)
  amvsstcighyqkcvnadkpccsktvrygdsknvrkficdrdgegvcvpfdggvrglpng
  a
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >1xj1A (A:)
  tcighyqkcvnadkpccsktvrygdsknvrkficdrdgegvcvpfdg