PDB entry 1xj0

View 1xj0 on RCSB PDB site
Description: Crystal Structure of the GDP-bound form of the RasG60A mutant
Class: signaling protein
Keywords: GDP, Ras, GTPase
Deposited on 2004-09-22, released 2005-05-10
The last revision prior to the SCOP 1.73 freeze date was dated 2005-05-10, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.228
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: transforming protein p21/h-ras-1
    Species: HOMO SAPIENS
    Gene: HRAS, HRAS1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P01112 (0-165)
      • engineered (59)
      • modified residue (117)
    Domains in SCOP 1.73: d1xj0a1
  • Heterogens: MG, GDP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1xj0A (A:)
    mteyklvvvgaggvgksaltiqliqnhfvdeydptiedsyrkqvvidgetclldildtaa
    qeeysamrdqymrtgegflcvfainntksfedihqyreqikrvkdsddvpmvlvgnkcdl
    aartvesrqaqdlarsygipyietsaktrqgvedafytlvreirqh