PDB entry 1xiz

View 1xiz on RCSB PDB site
Description: Structural Genomics, The crystal structure of domain IIA of putative phosphotransferase system specific for mannitol/fructose from Salmonella typhimurium
Class: structural genomics, unknown function
Keywords: Structural genomics, IIA domain, protein structure initiative, Midwest Center for Structural Genomics, MCSG, PSI
Deposited on 2004-09-22, released 2004-11-09
The last revision prior to the SCOP 1.73 freeze date was dated 2005-01-18, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.203
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: putative phosphotransferase system mannitol/fructose-specific IIA domain
    Species: Salmonella typhimurium
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8ZL18 (2-End)
      • cloning artifact (0-1)
    Domains in SCOP 1.73: d1xiza_
  • Chain 'B':
    Compound: putative phosphotransferase system mannitol/fructose-specific IIA domain
    Species: Salmonella typhimurium
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8ZL18 (2-End)
      • cloning artifact (1)
    Domains in SCOP 1.73: d1xizb_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1xizA (A:)
    namqdihfrrhyvrhlpkevsqndiikalasplindgmvvsdfadhvitreqnfptglpv
    epvgvaiphtdhkyvrqnaisvgilaepvnfedmggepdpvpvrvvfmlalgesnkqlnv
    lgwimdviqdedfmqqllvmnddeiyqsiytrisergev
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xizA (A:)
    namqdihfrrhyvrhlpkevsqndiikalasplindgmvvsdfadhvitreqnfptglpv
    epvgvaiphtdhkyvrqnaisvgilaepvnfedmggepdpvpvrvvfmlalgesnkqlnv
    lgwimdviqdedfmqqllvmnddeiyqsiytrise
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1xizB (B:)
    namqdihfrrhyvrhlpkevsqndiikalasplindgmvvsdfadhvitreqnfptglpv
    epvgvaiphtdhkyvrqnaisvgilaepvnfedmggepdpvpvrvvfmlalgesnkqlnv
    lgwimdviqdedfmqqllvmnddeiyqsiytrisergev
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xizB (B:)
    amqdihfrrhyvrhlpkevsqndiikalasplindgmvvsdfadhvitreqnfptglpve
    pvgvaiphtdhkyvrqnaisvgilaepvnfedmggepdpvpvrvvfmlalgesnkqlnvl
    gwimdviqdedfmqqllvmnddeiyqsiytriserg