PDB entry 1xiy

View 1xiy on RCSB PDB site
Description: Crystal Structure of Plasmodium falciparum antioxidant protein (1-Cys peroxiredoxin)
Class: oxidoreductase
Keywords: alpha-aneurysm, thioredoxin fold, peroxiredoxin fold, OXIDOREDUCTASE
Deposited on 2004-09-22, released 2005-02-15
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.187
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: peroxiredoxin
    Species: Plasmodium falciparum [TaxId:5833]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q5MYR6 (1-End)
      • initiating methionine (0)
      • modified residue (58)
      • see remark 999 (117)
    Domains in SCOPe 2.07: d1xiya1
  • Chain 'B':
    Compound: peroxiredoxin
    Species: Plasmodium falciparum [TaxId:5833]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q5MYR6
      • modified residue (58)
      • see remark 999 (117)
    Domains in SCOPe 2.07: d1xiyb_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1xiyA (A:)
    mkendlipnvkvmidvrnmnnisdtdgspndftsidthelfnnkkillislpgaftptcs
    tkmipgyeeeydyfikennfddiycitnndiyvlkswfksmdikkikyisdgnssftdsm
    nmlvdksnffmgmrpwrfvaivennilvkmfqekdkqhniqtdpydistvnnvkeflknn
    ql
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xiyA (A:)
    mkendlipnvkvmidvrnmnnndftsidthelfnnkkillislpgaftptcstkmipgye
    eeydyfikennfddiycitnndiyvlkswfksmdikkikyisdgnssftdsmnmlvdksn
    ffmgmrpwrfvaivennilvkmfqekdkqhniqtdpydistvnnvkeflknn
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1xiyB (B:)
    mkendlipnvkvmidvrnmnnisdtdgspndftsidthelfnnkkillislpgaftptcs
    tkmipgyeeeydyfikennfddiycitnndiyvlkswfksmdikkikyisdgnssftdsm
    nmlvdksnffmgmrpwrfvaivennilvkmfqekdkqhniqtdpydistvnnvkeflknn
    ql
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xiyB (B:)
    endlipnvkvmidvrnmnnisdtdgspndftsidthelfnnkkillislpgaftptcstk
    mipgyeeeydyfikennfddiycitnndiyvlkswfksmdikkikyisdgnssftdsmnm
    lvdksnffmgmrpwrfvaivennilvkmfqekdkqhniqtdpydistvnnvkeflknn