PDB entry 1xix

View 1xix on RCSB PDB site
Description: Crystal Structure of Weissella viridescens FemX Form II
Class: transferase
Keywords: crystal form II, FemX, ligase
Deposited on 2004-09-22, released 2005-05-31
The last revision prior to the SCOP 1.73 freeze date was dated 2005-05-31, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.175
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: FemX
    Species: Lactobacillus viridescens
    Gene: femx
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1xixa1, d1xixa2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1xixA (A:)
    pvlnlndpqaveryeefmrqspygqvtqdlgwakvknnwepvdvyleddqgaiiaamsml
    lgdtptdkkfayaskgpvmdvtdvdlldrlvdeavkaldgrayvlrfdpevaysdefntt
    lqdhgyvtrnrnvadagmhatiqprlnmvldltkfpdakttldlypsktkskikrpfrdg
    vevhsgnsateldeffktyttmaerhgithrpieyfqrmqaafdadtmrifvaeregkll
    stgialkygrkiwymyagsmdgntyyapyavqsemiqwaldtntdlydlggiesestdds
    lyvfkhvfvkdapreyigeidkvldpevyaelvkd