PDB entry 1xiw

View 1xiw on RCSB PDB site
Description: Crystal structure of human CD3-e/d dimer in complex with a UCHT1 single-chain antibody fragment
Class: membrane protein/Immune System
Keywords: CD3-epsilon, CD3-delta, UCHT1-scFv, immunoglobulin fold, antibody-antigen complex
Deposited on 2004-09-22, released 2004-11-16
The last revision prior to the SCOP 1.75 freeze date was dated 2004-12-07, with a file datestamp of 2007-06-28.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.204
AEROSPACI score: 0.56 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: T-cell surface glycoprotein CD3 epsilon chain
    Species: HOMO SAPIENS
    Gene: CD3E, T3E
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1xiwa_
  • Chain 'B':
    Compound: T-cell surface glycoprotein CD3 delta chain
    Species: HOMO SAPIENS
    Gene: CD3D, T3D
    Database cross-references and differences (RAF-indexed):
    • Uniprot P04234 (1-End)
      • initiating methionine (0)
    Domains in SCOP 1.75: d1xiwb_
  • Chain 'C':
    Compound: immunoglobulin light chain variable region
    Species: MUS MUSCULUS
    Gene: UCHT1
    Database cross-references and differences (RAF-indexed):
    • PIR PH0888 (1-End)
      • initiating methionine (0)
    Domains in SCOP 1.75: d1xiwc_
  • Chain 'D':
    Compound: immunoglobulin heavy chain variable region
    Species: MUS MUSCULUS
    Gene: UCHT1
    Database cross-references and differences (RAF-indexed):
    • PIR PH0887 (0-121)
      • see remark 999 (69)
      • see remark 999 (113)
      • see remark 999 (117)
      • see remark 999 (120)
    Domains in SCOP 1.75: d1xiwd_
  • Chain 'E':
    Compound: T-cell surface glycoprotein CD3 epsilon chain
    Species: HOMO SAPIENS
    Gene: CD3E, T3E
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1xiwe_
  • Chain 'F':
    Compound: T-cell surface glycoprotein CD3 delta chain
    Species: HOMO SAPIENS
    Gene: CD3D, T3D
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1xiwf_
  • Chain 'G':
    Compound: immunoglobulin light chain variable region
    Species: MUS MUSCULUS
    Gene: UCHT1
    Database cross-references and differences (RAF-indexed):
    • PIR PH0888 (1-End)
      • initiating methionine (0)
    Domains in SCOP 1.75: d1xiwg_
  • Chain 'H':
    Compound: immunoglobulin heavy chain variable region
    Species: MUS MUSCULUS
    Gene: UCHT1
    Database cross-references and differences (RAF-indexed):
    • PIR PH0887 (0-121)
      • see remark 999 (69)
      • see remark 999 (113)
      • see remark 999 (117)
      • see remark 999 (120)
    Domains in SCOP 1.75: d1xiwh_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1xiwA (A:)
    mdgneemggitqtpykvsisgttviltcpqypgseilwqhndkniggdeddknigsdedh
    lslkefseleqsgyyvcyprgskpedanfylylrarvcencmemd
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xiwA (A:)
    qtpykvsisgttviltcpqypgseilwqhndkniggdeddknigsdedhlslkefseleq
    sgyyvcyprgskpedanfylylrarvcencm
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1xiwB (B:)
    mkipieeledrvfvncntsitwvegtvgtllsditrldlgkrildprgiyrcngtdiykd
    kestvqvhyrmcqscveld
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xiwB (B:)
    mkipieeledrvfvncntsitwvegtvgtllsditrldlgkrildprgiyrcnestvqvh
    yrmcqs
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1xiwC (C:)
    mdiqmtqttsslsaslgdrvtiscrasqdirnylnwyqqkpdgtvklliyytsrlhsgvp
    skfsgsgsgtdysltisnleqediatyfcqqgntlpwtfaggtkleik
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xiwC (C:)
    mdiqmtqttsslsaslgdrvtiscrasqdirnylnwyqqkpdgtvklliyytsrlhsgvp
    skfsgsgsgtdysltisnleqediatyfcqqgntlpwtfaggtklei
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1xiwD (D:)
    evqlqqsgpelvkpgasmkisckasgysftgytmnwvkqshgknlewmglinpykgvsty
    nqkfkdkatltvdkssstaymellsltsedsavyycarsgyygdsdwyfdvwgqgttltv
    fs
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1xiwE (E:)
    mdgneemggitqtpykvsisgttviltcpqypgseilwqhndkniggdeddknigsdedh
    lslkefseleqsgyyvcyprgskpedanfylylrarvcencmemd
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xiwE (E:)
    qtpykvsisgttviltcpqypgseilwqhndkniggdeddknigsdedhlslkefseleq
    sgyyvcyprgskpedanfylylrarvc
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1xiwF (F:)
    mkipieeledrvfvncntsitwvegtvgtllsditrldlgkrildprgiyrcngtdiykd
    kestvqvhyrmcqscveld
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xiwF (F:)
    kipieeledrvfvncntsitwvegtvgtllsditrldlgkrildprgiyrcnestvqvhy
    rmc
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >1xiwG (G:)
    mdiqmtqttsslsaslgdrvtiscrasqdirnylnwyqqkpdgtvklliyytsrlhsgvp
    skfsgsgsgtdysltisnleqediatyfcqqgntlpwtfaggtkleik
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xiwG (G:)
    mdiqmtqttsslsaslgdrvtiscrasqdirnylnwyqqkpdgtvklliyytsrlhsgvp
    skfsgsgsgtdysltisnleqediatyfcqqgntlpwtfaggtklei
    

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1xiwH (H:)
    evqlqqsgpelvkpgasmkisckasgysftgytmnwvkqshgknlewmglinpykgvsty
    nqkfkdkatltvdkssstaymellsltsedsavyycarsgyygdsdwyfdvwgqgttltv
    fs