PDB entry 1xiq

View 1xiq on RCSB PDB site
Description: plasmodium falciparum nucleoside diphosphate kinase b
Deposited on 2004-09-21, released 2004-10-12
The last revision prior to the SCOP 1.71 freeze date was dated 2004-10-12, with a file datestamp of 2004-10-12.
Experiment type: XRAY
Resolution: 3.05 Å
R-factor: 0.232
AEROSPACI score: 0.18 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.71: d1xiqa_
  • Chain 'B':
    Domains in SCOP 1.71: d1xiqb_
  • Chain 'C':
    Domains in SCOP 1.71: d1xiqc_
  • Chain 'D':
    Domains in SCOP 1.71: d1xiqd_
  • Chain 'E':
    Domains in SCOP 1.71: d1xiqe_
  • Chain 'F':
    Domains in SCOP 1.71: d1xiqf_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1xiqA (A:)
    mahhhhhhmeksfimikpdgvqrglvgtiikrfekkgykliaikmlnpteeilkehykel
    sdqpffknlvayiskgpvvamvwegvdmvkqgrkligetnpltsntgtirgdfclevskn
    vihgsdsvasankeiniwfkaeeltqwkhhmkewics
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xiqA (A:)
    meksfimikpdgvqrglvgtiikrfekkgykliaikmlnpteeilkehykelsdqpffkn
    lvayiskgpvvamvwegvdmvkqgrkligetnpltsntgtirgdfclevsknvihgsdsv
    asankeiniwfkaeeltqwkhhmkewics
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1xiqB (B:)
    mahhhhhhmeksfimikpdgvqrglvgtiikrfekkgykliaikmlnpteeilkehykel
    sdqpffknlvayiskgpvvamvwegvdmvkqgrkligetnpltsntgtirgdfclevskn
    vihgsdsvasankeiniwfkaeeltqwkhhmkewics
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xiqB (B:)
    meksfimikpdgvqrglvgtiikrfekkgykliaikmlnpteeilkehykelsdqpffkn
    lvayiskgpvvamvwegvdmvkqgrkligetnpltsntgtirgdfclevsknvihgsdsv
    asankeiniwfkaeeltqwkhhmkewics
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1xiqC (C:)
    mahhhhhhmeksfimikpdgvqrglvgtiikrfekkgykliaikmlnpteeilkehykel
    sdqpffknlvayiskgpvvamvwegvdmvkqgrkligetnpltsntgtirgdfclevskn
    vihgsdsvasankeiniwfkaeeltqwkhhmkewics
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xiqC (C:)
    meksfimikpdgvqrglvgtiikrfekkgykliaikmlnpteeilkehykelsdqpffkn
    lvayiskgpvvamvwegvdmvkqgrkligetnpltsntgtirgdfclevsknvihgsdsv
    asankeiniwfkaeeltqwkhhmkewics
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1xiqD (D:)
    mahhhhhhmeksfimikpdgvqrglvgtiikrfekkgykliaikmlnpteeilkehykel
    sdqpffknlvayiskgpvvamvwegvdmvkqgrkligetnpltsntgtirgdfclevskn
    vihgsdsvasankeiniwfkaeeltqwkhhmkewics
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xiqD (D:)
    meksfimikpdgvqrglvgtiikrfekkgykliaikmlnpteeilkehykelsdqpffkn
    lvayiskgpvvamvwegvdmvkqgrkligetnpltsntgtirgdfclevsknvihgsdsv
    asankeiniwfkaeeltqwkhhmkewics
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1xiqE (E:)
    mahhhhhhmeksfimikpdgvqrglvgtiikrfekkgykliaikmlnpteeilkehykel
    sdqpffknlvayiskgpvvamvwegvdmvkqgrkligetnpltsntgtirgdfclevskn
    vihgsdsvasankeiniwfkaeeltqwkhhmkewics
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xiqE (E:)
    meksfimikpdgvqrglvgtiikrfekkgykliaikmlnpteeilkehykelsdqpffkn
    lvayiskgpvvamvwegvdmvkqgrkligetnpltsntgtirgdfclevsknvihgsdsv
    asankeiniwfkaeeltqwkhhmkewics
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1xiqF (F:)
    mahhhhhhmeksfimikpdgvqrglvgtiikrfekkgykliaikmlnpteeilkehykel
    sdqpffknlvayiskgpvvamvwegvdmvkqgrkligetnpltsntgtirgdfclevskn
    vihgsdsvasankeiniwfkaeeltqwkhhmkewics
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xiqF (F:)
    meksfimikpdgvqrglvgtiikrfekkgykliaikmlnpteeilkehykelsdqpffkn
    lvayiskgpvvamvwegvdmvkqgrkligetnpltsntgtirgdfclevsknvihgsdsv
    asankeiniwfkaeeltqwkhhmkewics