PDB entry 1xip

View 1xip on RCSB PDB site
Description: Crystal Structure of the N-terminal Domain of Nup159
Class: transport protein
Keywords: beta-propeller, TRANSPORT PROTEIN
Deposited on 2004-09-21, released 2004-12-14
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.206
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Nucleoporin NUP159
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: NUP159
    Database cross-references and differences (RAF-indexed):
    • Uniprot P40477 (2-End)
      • cloning artifact (1)
      • modified residue (193)
      • modified residue (247)
      • modified residue (278)
    Domains in SCOPe 2.07: d1xipa1, d1xipa2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1xipA (A:)
    gasslkdevptetsedfgfkflgqkqilpsfneklpfaslqnldisnskslfvaasgska
    vvgelqllrdhitsdstpltfkwekeipdvifvcfhgdqvlvstrnalysldleelsefr
    tvtsfekpvfqlknvnntlvilnsvndlsaldlrtkstkqlaqnvtsfdvtnsqlavllk
    drsfqsfawrngemekqfefslpseleelpveeysplsvtilspqdflavfgnvisetdd
    evsydqkmyiikhidgsasfqetfditppfgqivrfpymykvtlsgliepdanvnvlass
    cssevsiwdskqviepsqdseravlpiseetdkdtnpigvavdvvtsgtilepcsgvdti
    erlplvyilnnegslqivglfhvaaiks
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xipA (A:)
    asslkdevptetsedfgfkflgqkqilpsfneklpfaslqnldisnskslfvaasgskav
    vgelqllrdhitsdstpltfkwekeipdvifvcfhgdqvlvstrnalysldleelsefrt
    vtsfekpvfqlknvnntlvilnsvndlsaldlrtkstkqlaqnvtsfdvtnsqlavllkd
    rsfqsfawrngemekqfefslpseleelpveeysplsvtilspqdflavfgnvisetdde
    vsydqkmyiikhidgsasfqetfditppfgqivrfpymykvtlsgliepdanvnvlassc
    ssevsiwdskqviepsqdseravlpiseetdkdtnpigvavdvvtsglplvyilnnegsl
    qivglfh