PDB entry 1xio

View 1xio on RCSB PDB site
Description: Anabaena sensory rhodopsin
Class: signaling protein
Keywords: signaling protein, photoreceptor
Deposited on 2004-09-21, released 2004-10-05
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: anabaena sensory rhodopsin
    Species: Nostoc sp. PCC 7120 [TaxId:103690]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1xioa_
  • Heterogens: RET, PEE, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1xioA (A:)
    mnlesllhwiyvagmtigalhfwslsrnprgvpqyeylvamfipiwsglaymamaidqgk
    veaagqiahyaryidwmvttpllllslswtamqfikkdwtligflmstqivvitsgliad
    lserdwvrylwyicgvcafliilwgiwnplraktrtqsselanlydklvtyftvlwigyp
    ivwiigpsgfgwinqtidtflfcllpffskvgfsfldlhglrnlndsrqttgdrfaentl
    qfvenitlfansrrqqsrrrv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xioA (A:)
    mnlesllhwiyvagmtigalhfwslsrnprgvpqyeylvamfipiwsglaymamaidiah
    yaryidwmvttpllllslswtamqfikkdwtligflmstqivvitsgliadlserdwvry
    lwyicgvcafliilwgiwnplraktrtqsselanlydklvtyftvlwigypivwiigpsg
    fgwinqtidtflfcllpffskvgfsfldlhglrnlnd