PDB entry 1xil

View 1xil on RCSB PDB site
Description: hydrogen bonding in human manganese superoxide dismutase containing 3-fluorotyrosine
Class: oxidoreductase
Keywords: MnSOD, Manganese Superoxide Dismutase, 3-Fluorotyrosine, OXIDOREDUCTASE
Deposited on 2004-09-21, released 2005-03-08
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.53 Å
R-factor: 0.148
AEROSPACI score: 0.65 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Superoxide dismutase [Mn], mitochondrial
    Species: Homo sapiens [TaxId:9606]
    Gene: SOD2
    Database cross-references and differences (RAF-indexed):
    • Uniprot P04179 (0-197)
      • modified residue (8)
      • modified residue (10)
      • engineered (33)
      • modified residue (44)
      • modified residue (164-165)
      • modified residue (168)
      • modified residue (175)
      • modified residue (192)
    Domains in SCOPe 2.07: d1xila1, d1xila2
  • Chain 'B':
    Compound: Superoxide dismutase [Mn], mitochondrial
    Species: Homo sapiens [TaxId:9606]
    Gene: SOD2
    Database cross-references and differences (RAF-indexed):
    • Uniprot P04179 (0-197)
      • modified residue (8)
      • modified residue (10)
      • engineered (33)
      • modified residue (44)
      • modified residue (164-165)
      • modified residue (168)
      • modified residue (175)
      • modified residue (192)
    Domains in SCOPe 2.07: d1xilb1, d1xilb2
  • Heterogens: MN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1xilA (A:)
khslpdlpydygalephinaqimqlhhskhhaafvnnlnvteekyqealakgdvtaqial
qpalkfnggghinhsifwtnlspngggepkgelleaikrdfgsfdkfkekltaasvgvqg
sgwgwlgfnkerghlqiaacpnqdplqgttglipllgidvwehayylqyknvrpdylkai
wnvinwenvterymackk

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1xilB (B:)
khslpdlpydygalephinaqimqlhhskhhaafvnnlnvteekyqealakgdvtaqial
qpalkfnggghinhsifwtnlspngggepkgelleaikrdfgsfdkfkekltaasvgvqg
sgwgwlgfnkerghlqiaacpnqdplqgttglipllgidvwehayylqyknvrpdylkai
wnvinwenvterymackk