PDB entry 1xii

View 1xii on RCSB PDB site
Description: modes of binding substrates and their analogues to the enzyme d-xylose isomerase
Class: isomerase(intramolecular oxidoreductase)
Keywords: isomerase(intramolecular oxidoreductase)
Deposited on 1994-03-07, released 1994-06-22
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.147
AEROSPACI score: 0.59 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: d-xylose isomerase
    Species: Streptomyces rubiginosus [TaxId:1929]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P24300
      • conflict (40)
    Domains in SCOPe 2.07: d1xiia_
  • Heterogens: XUL, MN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1xiiA (A:)
    mnyqptpedrftfglwtvgwqgrdpfgdatrraldpvesvqrlaelgahgvtfhdddlip
    fgssdsereehvkrfrqalddtgmkvpmattnlfthpvfkdggftandrdvrryalrkti
    rnidlavelgaetyvawggregaesggakdvrdaldrmkeafdllgeyvtsqgydirfai
    epkpneprgdillptvghalafierlerpelygvnpevgheqmaglnfphgiaqalwagk
    lfhidlngqngikydqdlrfgagdlraafwlvdllesagysgprhfdfkpprtedfdgvw
    asaagcmrnylilkeraaafradpevqealrasrldelarptaadglqallddrsafeef
    dvdaaaargmaferldqlamdhllgarg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xiiA (A:)
    yqptpedrftfglwtvgwqgrdpfgdatrraldpvesvqrlaelgahgvtfhdddlipfg
    ssdsereehvkrfrqalddtgmkvpmattnlfthpvfkdggftandrdvrryalrktirn
    idlavelgaetyvawggregaesggakdvrdaldrmkeafdllgeyvtsqgydirfaiep
    kpneprgdillptvghalafierlerpelygvnpevgheqmaglnfphgiaqalwagklf
    hidlngqngikydqdlrfgagdlraafwlvdllesagysgprhfdfkpprtedfdgvwas
    aagcmrnylilkeraaafradpevqealrasrldelarptaadglqallddrsafeefdv
    daaaargmaferldqlamdhllgar